1. GPCR/G Protein
  2. CRFR
  3. Corticotropin-releasing factor (human)

Corticotropin-releasing factor (human) (Synonyms: Human CRF; Human corticotropin-releasing factor)

Cat. No.: HY-P0086
Handling Instructions

Corticotropin-releasing factor human (Human CRF; Human corticotropin-releasing factor) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Corticotropin-releasing factor (human) Chemical Structure

Corticotropin-releasing factor (human) Chemical Structure

CAS No. : 86784-80-7

Size Price Stock
250 μg USD 60 Ask For Quote & Lead Time
500 μg USD 96 Ask For Quote & Lead Time
1 mg USD 156 Ask For Quote & Lead Time
5 mg USD 552 Ask For Quote & Lead Time
10 mg USD 960 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Other In-stock Forms of Corticotropin-releasing factor (human):

Other Forms of Corticotropin-releasing factor (human):

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Corticotropin-releasing factor human (Human CRF; Human corticotropin-releasing factor) stimulates the synthesis and secretion of adrenocorticotropin in the anterior pituitary.

In Vitro

CRF increases excitability of type II dlBNST neurons through activation of the AC-cAMP-PKA pathway, thereby causing pain-induced aversive responses[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

In rats injected with CRF (1 nmol/side), the time spent in the drug-paired compartment during the test session (314±22 s) is significantly shorter than time spent in that compartment during the preconditioning session (520±18 s)[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4757.45

Formula

C₂₀₈H₃₄₄N₆₀O₆₃S₂

CAS No.

86784-80-7

Sequence

Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2

Sequence Shortening

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage
Powder -80°C 2 years
-20°C 1 year
In solvent -80°C 6 months
-20°C 1 month
Solvent & Solubility
In Vitro: 

H2O : 16.66 mg/mL (3.50 mM; Need ultrasonic and warming)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2102 mL 1.0510 mL 2.1020 mL
5 mM --- --- ---
10 mM --- --- ---
*Please refer to the solubility information to select the appropriate solvent.
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Corticotropin-releasing factor (human)Human CRF Human corticotropin-releasing factorCRFRCorticotropin-releasing Factor ReceptorInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Corticotropin-releasing factor (human)
Cat. No.:
HY-P0086
Quantity:
MCE Japan Authorized Agent: