Neurological Disease

(-)-Secoisolariciresinol 4-O-β-D-glucopyranoside is a lignan that can be found in the roots and rhizomes of Valeriana amurensis. (-)-Secoisolariciresinol 4-O-β-D-glucopyranoside shows no significant neuroprotective effect against Aβ_1-42-induced injury to neuronal cells.

Amlodipine (maleate) (Standard) is the analytical standard of Amlodipine (maleate). This product is intended for research and analytical applications. Amlodipine maleate is a dihydropyridine calcium channel blocker, acts as an orally active antianginal agent. Amlodipine maleate blocks the voltage-dependent L-type calcium channels, thereby inhibiting the initial influx of calcium. Amlodipine maleate can be used for the research of high blood pressure and cancer.

LRRK2 inhibitor 1 (Standard) is the analytical standard of LRRK2 inhibitor 1 (HY-111493). This product is intended for research and analytical applications. LRRK2 inhibitor 1 is a potent, selective and oral LRRK2 inhibitor with an pIC₅₀ of 6.8.

JZL195 (Standard) is the analytical standard of JZL195. This product is intended for research and analytical applications. JZL195 is a selective and efficacious dual fatty acid amide hydrolase (FAAH) and monoacylglycerol lipase (MAGL) inhibitor with IC50s of 2 and 4 nM, respectively.

GMQ hydrochloride (Standard) is the analytical standard of GMQ (hydrochloride) (HY-107757). This product is intended for research and analytical applications. GMQ (hydrochloride) is a ASIC (acid-sensing ion) channel activator with an EC₅₀ value of 1.83 mM for ASIC3 at pH 7.4. GMQ (hydrochloride) opens only ASIC3 but no other ASICs at pH 7.4. GMQ (hydrochloride) can be used for neurological disease research.

Promethazine sulfoxide is a metabolite of the histamine H1 receptor antagonist Promethazine (HY-B1296). It is formed from promethazine by the cytochrome P450 (CYP) isoform CYP2D6.

N6-Cyclopentyladenosine (Standard) is the analytical standard of N6-Cyclopentyladenosine (HY-103181). This product is intended for research and analytical applications. N6-Cyclopentyladenosine (CPA) is a selective Adenosine A1 receptor agonist, with K_i values of 2.3 nM, 790 nM and 43 nM for human A1, A2A and A3 receptors, respectively. N6-cyclopentyladenosine increases Apoptosis. N6-Cyclopentyladenosine has antitumor activity against leukemia. N6-cyclopentyladenosine improves 5-fluorouracil (HY-90006)-induced hematopoietic damage, regulates sleep, and delays Aminophylline-induced clonic epileptic seizures.

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.

BMS-986188 is a selective positive allosteric modulator of δ-opioid receptor with an EC₅₀ of 0.05 μM.

epi-Aszonalenin A is a benzodiazepine fungal metabolite originally isolated from Aspergillus novofumigatus. epi-Aszonalenin A can be used as a psychoactive agent.

UBP296 is a potent and selective antagonist of GLU_K5-containing kainate receptor in the spinal cord. UBP296 reversibly blocks ATPA-induced depressions of synaptic transmission, and affects AMPA receptor-mediated synaptic transmission directly in rat hippocampal slices.

4,27-Dimethyl withaferin A is a synthetic analog of withanolide natural products. 4,27-Dimethyl withaferin A has the potential for the research of neurodegenerative diseases (extracted from patent WO2015077780A1).

AGI-12026 is brain-penetrant dual inhibitor of mutant IDH1 and 2. AGI-12026 shows partial inhibition of the IDH1-R132H homodimer as allosteric modulators. AGI-12026 has the potential for research of glioma.

TAE-1 is a potent inhibitor of AChE and BuChE. TAE-1 also inhibits Aβ fibril formation and aggregation. TAE-1 can be used for the researches of Alzheimer's disease.

Ordopidine hydrochloride is a modulator of dopamine receptor extracted from patent WO/2005/121087A1, compound example 2; exhibits an ED₅₀ of 68 μmol/kg on increase of DOPAC in the rat striatum.

Nisobamate (W1015) is a tranquilizer.

ST4206 is a potent and orally active adenosine A2A receptor antagonist, with K_is of 12 nM and 197 nM for adenosine A2A receptor and adenosine A1 receptor, respectively. ST4206 has the potential for Parkinson׳s disease research.

Myomodulin is a neuropeptide present in molluscs, insects, and gastropods.

Endomorphin 2, a high affinity, highly selective agonist of the μ-opioid receptor, displays reasonable affinities for kappa₃ binding sites, with K_i value between 20 and 30 nM.