Aa1 toxin
Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases.
For research use only. We do not sell to patients.
- Formula: C156H260N54O49S6
- Molecular Weight:3868.46
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
Chemical Information
-
Molecular Weight 3868.46
-
Formula C156H260N54O49S6
-
Sequence
Gln-Asn-Glu-Thr-Asn-Lys-Lys-Cys-Gln-Gly-Gly-Ser-Cys-Ala-Ser-Val-Cys-Arg-Arg-Val-Ile-Gly-Val-Ala-Ala-Gly-Lys-Cys-Ile-Asn-Gly-Arg-Cys-Val-Cys-Tyr-Pro (Disulfide bridge: Cys8-Cys28; Cys13-Cys33; Cys17-Cys35)
-
Sequence Shortening
QNETNKKCQGGSCASVCRRVIGVAAGKCINGRCVCYP (Disulfide bridge: Cys8-Cys28; Cys13-Cys33; Cys17-Cys35)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Neurotoxicity Study
This protocol assesses in vitro neurotoxicity by combining neuronal viability, mitochondrial/metabolic activity, neurite outgrowth, and optional neuronal network function readouts. Calcein-AM or resazurin/PrestoBlue readouts estimate viable or metabolically active cells; βIII-tubulin immunofluorescence detects neuronal morphology and neurite networks; TMRE detects mitochondrial membrane potential; and MEA recordings detect functional changes in neuronal network activity.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)