Agitoxin-2
Agitoxin-2 is a K+ channel inhibitor, with IC50 values of 201 pM and 144 pM for mKV1.3 and mKV1.1, respectively).
For research use only. We do not sell to patients.
- CAS No.: 168147-41-9
- Formula: C169H278N54O48S8
- Molecular Weight:4090.87
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
-
HY-P1280
MargatoxinKv1.3 Inhibitor -
HY-N6693
ValinomycinAntibiotic -
HY-P0190
IberiotoxinCa2+-activated K+ Channel Inhibitor -
HY-P0256
ApaminPotassium Channel Inhibitor -
HY-P0191
CharybdotoxinPotassium Channel Inhibitor -
HY-B0112
MinoxidilEndogenous Metabolite -
HY-B0232
DofetilideIKr Blocker -
HY-B0401
TolbutamideKATP Inhibitor -
HY-B0401R
Tolbutamide (Standard)KATP Inhibitor -
HY-15551
E-4031hERG Channels Blocker -
HY-15209
RepaglinideInsulin Secretagogue -
HY-B0422
NateglinideK+ Channel Inhibitor
Biological Activity
Description
Chemical Information
-
CAS No. 168147-41-9
-
Molecular Weight 4090.87
-
Formula C169H278N54O48S8
-
Sequence
Gly-Val-Pro-Ile-Asn-Val-Ser-Cys-Thr-Gly-Ser-Pro-Gln-Cys-Ile-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
-
Sequence Shortening
GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bridge:Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Solvent & Solubility
In Vitro
H2O
Peptide Solubility and Storage Guidelines:
1. Calculate the length of the peptide.
2. Calculate the overall charge of the entire peptide according to the following table:
| Contents | Assign value | |
|---|---|---|
| Acidic amino acid | Asp (D), Glu (E), and the C-terminal -COOH. | -1 |
| Basic amino acid | Arg (R), Lys (K), His (H), and the N-terminal -NH2 | +1 |
| Neutral amino acid | Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) | 0 |
3. Recommended solution:
| Overall charge of peptide | Details |
|---|---|
| Negative (<0) |
1. Try to dissolve the peptide in water first. 2. If water fails, add NH4OH (<50 μL). 3. If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide. |
| Positive (>0) |
1. Try to dissolve the peptide in water first. 2. If water fails, try dissolving the peptide in a 10%-30% acetic acid solution. 3. If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO. |
| Zero (=0) |
1. Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first. 2. For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration. |
Protocols
-
Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.
Purity & Documentation
References
[1]. M L Garcia, et al. Purification and characterization of three inhibitors of voltage-dependent K+ channels from Leiurus quinquestriatus var. hebraeus venom. Biochemistry. 1994 Jun 7;33(22):6834-9. [Content Brief]
[2]. Raveendra Anangi, et al. Recombinant expression of margatoxin and agitoxin-2 in Pichia pastoris: an efficient method for production of KV1.3 channel blockers. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Agitoxin-2 Related Classifications
HY-P1282 Related Classifications
Powered by Bioz