1. Membrane Transporter/Ion Channel
  2. Potassium Channel
  3. AmmTX3

AmmTX3 is a peptide toxin identified from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is a highly specific blocker of Kv4 channels, which selectively and almost completely blocks transient A-type K+ currents with a Ki of 131 nM. AmmTX3 induces epileptiform behaviors and causes death in mice receiving intracerebroventricular injection. AmmTX3 increases the excitability of dentate gyrus granule cells, reduces GABAergic inhibition, enhances and stabilizes the EPSP-spike component of long-term potentiation, and impairs reference memory. AmmTX3 can be used in research related to pain, epilepsy, and autism spectrum disorder.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

AmmTX3

AmmTX3 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of AmmTX3:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

AmmTX3 is a peptide toxin identified from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is a highly specific blocker of Kv4 channels, which selectively and almost completely blocks transient A-type K+ currents with a Ki of 131 nM. AmmTX3 induces epileptiform behaviors and causes death in mice receiving intracerebroventricular injection. AmmTX3 increases the excitability of dentate gyrus granule cells, reduces GABAergic inhibition, enhances and stabilizes the EPSP-spike component of long-term potentiation, and impairs reference memory. AmmTX3 can be used in research related to pain, epilepsy, and autism spectrum disorder[1][2][3].

IC50 & Target

Kv4 channel[2]

In Vitro

AmmTX3 (1 h) binds with high affinity to a specific site on rat brain synaptosomes, fully displacing 125I-labelled sBmTX3 with a Ki of 19.5 pM, and exhibits a Kd of 66 pM for its own binding site[1].
AmmTX3 (0.1 nM-10 μM) potently blocks the A-type K+ current in primary striatal neurons in culture, with a Ki of 131 nM, and its inhibitory effect is reversible[1].
AmmTX3 (0.5 μM) potently blocks Kv4.2 channel currents in CHO-K1 cells co-expressed with DPP6S (with or without KChIP1), but only weakly blocks Kv4.2 + KChIP1 currents, demonstrating DPP6S confers high AmmTX3 sensitivity to Kv4.2 channels[3].
AmmTX3 (0.5 μM) potently blocks Kv4.3 channel currents in CHO-K1 cells co-expressed with DPP10a, but only weakly blocks Kv4.3 + KChIP1 currents, demonstrating DPP10a confers high AmmTX3 sensitivity to Kv4.3 channels[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

AmmTX3 (0.75 mg; i.c.v.; single injection) impairs spatial reference memory consolidation when administered during early stages of eight-arm radial maze training, causing a 1-day learning delay when injected after session 1 and increasing reference memory errors in session 4 when injected after session 3, with no effect on working memory[2].
AmmTX3 (0.75 mg; i.c.v.; single injection) increases and stabilizes the EPSP-spike component of long-term potentiation in the dentate gyrus from 90 minutes post-high-frequency stimulation, with no effect on basal synaptic transmission or short-term plasticity[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Sprague Dawley (male, 280-400 g)[2]
Dosage: 0.75 mg
Administration: i.c.v.; single injection
Result: Showed no significant differences in reference or working memory errors when injected 30 minutes before session 2.
Significantly increased reference memory errors in sessions 2 and 3, delayed learning by 1 day, and significantly increased total turns and 45° turns in sessions 2, 3, and 4 when injected immediately after session 1.
Significantly increased reference memory errors in session 4 when injected immediately after session 3.
Showed no significant differences in reference or working memory errors when injected immediately after session 5.
Animal Model: Sprague Dawley (male, 280-400 g)[2]
Dosage: 0.75 mg
Administration: i.c.v.; single injection
Result: Showed no significant differences in basal transmission (input-output curves, baseline field EPSP slope, population spike amplitude) or short-term plasticity (paired-pulse ratio) compared to vehicle group.
Increased field EPSP slope by 16.1% post-stimulation, remaining above baseline for 30 minutes, with no significant difference from vehicle group at any post-stimulation time point.
Maintained population spike amplitude above baseline for the full 4-hour recording period, while vehicle group's amplitude steadily decreased; significant difference between groups emerged 90 minutes post-induction.
Molecular Weight

3822.47

Formula

C158H262N50O48S6

Sequence

{Glp}-Ile-Glu-Thr-Asn-Lys-Lys-Cys-Gln-Gly-Gly-Ser-Cys-Ala-Ser-Val-Cys-Arg-Lys-Val-Ile-Gly-Val-Ala-Ala-Gly-Lys-Cys-Ile-Asn-Gly-Arg-Cys-Val-Cys-Tyr-Pro (Disulfide bridge:Cys8-Cys28,Cys13-Cys33,Cys17-Cys35)

Sequence Shortening

{Glp}-IETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP (Disulfide bridge:Cys8-Cys28,Cys13-Cys33,Cys17-Cys35)

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AmmTX3
Cat. No.:
HY-P1426
Quantity:
MCE Japan Authorized Agent: