2. Membrane Transporter/Ion Channel
  3. Potassium Channel
  4. AmmTX3

AmmTX3 is a peptide toxin identified from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is a highly specific blocker of Kv4 channels, which selectively and almost completely blocks transient A-type K+ currents with a Ki of 131 nM. AmmTX3 induces epileptiform behaviors and causes death in mice receiving intracerebroventricular injection. AmmTX3 increases the excitability of dentate gyrus granule cells, reduces GABAergic inhibition, enhances and stabilizes the EPSP-spike component of long-term potentiation, and impairs reference memory. AmmTX3 can be used in research related to pain, epilepsy, and autism spectrum disorder.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Custom Peptide Synthesis

AmmTX3

AmmTX3 화학구조

사이즈 재고
50 mg   견적 받기  
100 mg   견적 받기  
250 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

This product is a controlled substance and not for sale in your territory.

Other Forms of AmmTX3:

AmmTX3 Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • 순도&문서

  • References

  • 고객리뷰

제품 설명

AmmTX3 is a peptide toxin identified from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is a highly specific blocker of Kv4 channels, which selectively and almost completely blocks transient A-type K+ currents with a Ki of 131 nM. AmmTX3 induces epileptiform behaviors and causes death in mice receiving intracerebroventricular injection. AmmTX3 increases the excitability of dentate gyrus granule cells, reduces GABAergic inhibition, enhances and stabilizes the EPSP-spike component of long-term potentiation, and impairs reference memory. AmmTX3 can be used in research related to pain, epilepsy, and autism spectrum disorder[1][2][3].

IC50 & Target

Kv4 channel[2]
In Vitro

AmmTX3 (1 h) binds with high affinity to a specific site on rat brain synaptosomes, fully displacing 125I-labelled sBmTX3 with a Ki of 19.5 pM, and exhibits a Kd of 66 pM for its own binding site[1].
AmmTX3 (0.1 nM-10 μM) potently blocks the A-type K+ current in primary striatal neurons in culture, with a Ki of 131 nM, and its inhibitory effect is reversible[1].
AmmTX3 (0.5 μM) potently blocks Kv4.2 channel currents in CHO-K1 cells co-expressed with DPP6S (with or without KChIP1), but only weakly blocks Kv4.2 + KChIP1 currents, demonstrating DPP6S confers high AmmTX3 sensitivity to Kv4.2 channels[3].
AmmTX3 (0.5 μM) potently blocks Kv4.3 channel currents in CHO-K1 cells co-expressed with DPP10a, but only weakly blocks Kv4.3 + KChIP1 currents, demonstrating DPP10a confers high AmmTX3 sensitivity to Kv4.3 channels[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

AmmTX3 Related Antibodies
In Vivo

AmmTX3 (0.75 mg; i.c.v.; single injection) impairs spatial reference memory consolidation when administered during early stages of eight-arm radial maze training, causing a 1-day learning delay when injected after session 1 and increasing reference memory errors in session 4 when injected after session 3, with no effect on working memory[2].
AmmTX3 (0.75 mg; i.c.v.; single injection) increases and stabilizes the EPSP-spike component of long-term potentiation in the dentate gyrus from 90 minutes post-high-frequency stimulation, with no effect on basal synaptic transmission or short-term plasticity[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Sprague Dawley (male, 280-400 g)[2]
Dosage: 0.75 mg
Administration: i.c.v.; single injection
Result: Showed no significant differences in reference or working memory errors when injected 30 minutes before session 2.
Significantly increased reference memory errors in sessions 2 and 3, delayed learning by 1 day, and significantly increased total turns and 45° turns in sessions 2, 3, and 4 when injected immediately after session 1.
Significantly increased reference memory errors in session 4 when injected immediately after session 3.
Showed no significant differences in reference or working memory errors when injected immediately after session 5.
Animal Model: Sprague Dawley (male, 280-400 g)[2]
Dosage: 0.75 mg
Administration: i.c.v.; single injection
Result: Showed no significant differences in basal transmission (input-output curves, baseline field EPSP slope, population spike amplitude) or short-term plasticity (paired-pulse ratio) compared to vehicle group.
Increased field EPSP slope by 16.1% post-stimulation, remaining above baseline for 30 minutes, with no significant difference from vehicle group at any post-stimulation time point.
Maintained population spike amplitude above baseline for the full 4-hour recording period, while vehicle group's amplitude steadily decreased; significant difference between groups emerged 90 minutes post-induction.
분자량

3822.47

화학식

C158H262N50O48S6
Sequence

{Glp}-Ile-Glu-Thr-Asn-Lys-Lys-Cys-Gln-Gly-Gly-Ser-Cys-Ala-Ser-Val-Cys-Arg-Lys-Val-Ile-Gly-Val-Ala-Ala-Gly-Lys-Cys-Ile-Asn-Gly-Arg-Cys-Val-Cys-Tyr-Pro (Disulfide bridge:Cys8-Cys28,Cys13-Cys33,Cys17-Cys35)
Sequence Shortening

{Glp}-IETNKKCQGGSCASVCRKVIGVAAGKCINGRCVCYP (Disulfide bridge:Cys8-Cys28,Cys13-Cys33,Cys17-Cys35)
선적

Room temperature in continental US; may vary elsewhere.
보관

Please store the product under the recommended conditions in the Certificate of Analysis.
순도&문서
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

AmmTX3 Related Classifications

  • 몰농도 계산기

  • 농도 희석 계산기

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

AmmTX3AmmTX 3AmmTX-3Potassium ChannelKcsAwild-type cerebellar granule neuronsrat brain synaptosomesCHO-K1 cellslong-term potentiationKv4 channelsERG channelKv4.2 channeldentate gyrus granular cellA-type potassium channelGABAergic inhibitionInhibitorinhibitorinhibit

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

상품명

  

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

도

Country or Region *

      

비고

대량구매 문의

Inquiry Information

상품명:
AmmTX3
Cat. No.:
HY-P1426
수량:
MCE Japan Authorized Agent:

고객리뷰

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

상품명

  

Lot #

고객명 *

 

메일주소 *

전화번호

 

Department *

회사명 *

 

Country or Region *

비고

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.