ChTX-Lq2
ChTX-Lq2 is a Ca2+-activated K+ efflux inhibitor with a Kd of 43 nM.
For research use only. We do not sell to patients.
- Formula: C177H280N60O55S7
- Molecular Weight:4352.94
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
IC50 & Target
Kd: 43 nM (Ca2+-activated K+ efflux)[1]
Chemical Information
-
Molecular Weight 4352.94
-
Formula C177H280N60O55S7
-
Sequence
Gln-Phe-Thr-Gln-Glu-Ser-Cys-Thr-Ala-Ser-Asn-Gln-Cys-Trp-Ser-Ile-Cys-Lys-Arg-Leu-His-Asn-Thr-Asn-Arg-Gly-Lys-Cys-Met-Asn-Lys-Lys-Cys-Arg-Cys-Tyr-Ser (Disulfide bridge: Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)
-
Sequence Shortening
QFTQESCTASNQCWSICKRLHNTNRGKCMNKKCRCYS (Disulfide bridge: Cys7-Cys28,Cys13-Cys33,Cys17-Cys35)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Ca2+ Staining Technique
Ca2+ staining is an experimental technique that utilizes specific fluorescent probes (such as Fluo-4 AM, Fura-2, etc.) to qualitatively or quantitatively detect dynamic changes in intracellular Ca2+ concentrations; this is achieved by monitoring the changes in fluorescent signals generated when these probes bind to free intracellular calcium ions. The underlying principle relies primarily on the presence of chelating groups within the probe's molecular structure that possess high affinity for calcium ions.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
ChTX-Lq2 Related Classifications
HY-P5901 Related Classifications
Powered by Bioz