β-Endorphin, equine TFA
Based on 1 publication(s) in Google Scholar
β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties.
For research use only. We do not sell to patients.
- Purity: 97.10%
- Formula: C154H248N42O44S.xC2HF3O2
- Molecular Weight:3423.94 (free acid)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) β-Endorphin, equine TFA
MoreAll Opioid Receptor Isoforms
More
Biological Activity
|
δ Opioid Receptor/DOR |
μ Opioid Receptor/MOR |
β-Endorphin, equine TFA (0, 0.6, 1.2 and 3 μM) inhibits the striatal dopamine release[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Adult Female Wistar rats[3]
-
Dosage:2 or 20 μg/kg
-
Administration:2 or 20 μg/kg; i.p., once
-
Result:Hindered the acquisition of shuttle avoidance learning and habituation of a rearing response to a tone at a dose of 20 μg/kg. Caused amnesia in the avoidance task with the pre- or post-training administration of 2 μg/kg and pre-training administration of 20 μg/kg.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3423.94 (free acid)
-
Formula C154H248N42O44S.xC2HF3O2
-
Color White to off-white
-
Sequence
Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln
-
Sequence Shortening
YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
-
Structure Classification
-
Initial Source
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Domest Anim Endocrinol
Pilot study of β-endorphin concentrations in horses with pituitary pars intermedia dysfunction using a newly validated enzyme-linked immunosorbent assay. [Abstract]2025 Nov 26:95:106982. PMID: 41317409
Solvent & Solubility
H2O : 100 mg/mL (Need ultrasonic)
Purity & Documentation
-
Data Sheet (270 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[2]. Niinistö KE, et al. Plasma levels of heat shock protein 72 (HSP72) and beta-endorphin as indicators of stress, pain and prognosis in horses with colic. Vet J. 2010 Apr;184(1):100-4. [Content Brief]
[3]. Izquierdo I. Effects of a low and a high dose of beta-endorphin on acquisition and retention in the rat. Behav Neural Biol. 1980 Dec;30(4):460-4. [Content Brief]
[4]. Loh HH, et al. beta-Endorphin in vitro inhibition of striatal dopamine release. Nature. 1976 Dec 9;264(5586):567-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
β-Endorphin, equine TFA Related Classifications
HY-P1866A Related Classifications
Powered by Bioz