2. GPCR/G Protein Neuronal Signaling
  3. Opioid Receptor
  4. β-Endorphin, equine TFA

β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Endorphin, equine TFA Chemical Structure

β-Endorphin, equine TFA Chemical Structure

Size Price Stock Quantity
500 μg USD 90 In-stock
1 mg USD 150 In-stock
5 mg USD 350 In-stock
10 mg USD 600 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of β-Endorphin, equine TFA:

β-Endorphin, equine TFA Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties[1][2][3][4].

IC50 & Target

δ Opioid Receptor/DOR

 

μ Opioid Receptor/MOR

 

In Vitro

β-Endorphin, equine TFA (0, 0.6, 1.2 and 3 μM) inhibits the striatal dopamine release[4].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

β-Endorphin, equine TFA Related Antibodies
In Vivo

β-Endorphin, equine TFA (2 or 20 μg/kg; i.p., once) effects the acquisition and retention in the rat[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Adult Female Wistar rats[3]
Dosage: 2 or 20 μg/kg
Administration: 2 or 20 μg/kg; i.p., once
Result: Hindered the acquisition of shuttle avoidance learning and habituation of a rearing response to a tone at a dose of 20 μg/kg. Caused amnesia in the avoidance task with the pre- or post-training administration of 2 μg/kg and pre-training administration of 20 μg/kg.
Molecular Weight

3423.94 (free acid)

Formula

C154H248N42O44S.xC2HF3O2
Appearance

Solid

Color

White to off-white

Sequence

Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln
Sequence Shortening

YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
Structure Classification
Initial Source
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : 100 mg/mL (Need ultrasonic)

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

β-Endorphin, equine TFA Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

β-Endorphin, equineOpioid ReceptorpeptideratanalgesicdopamineInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
β-Endorphin, equine TFA
Cat. No.:
HY-P1866A
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.