β-Endorphin, equine TFA
Based on 1 publication(s) in Google Scholar
β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties.
For research use only. We do not sell to patients.
- Purity : 97.02%
- Formula: C154H248N42O44S.xC2HF3O2
- Molecular Weight:3423.94 (free acid)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) β-Endorphin, equine TFA
MoreAll Opioid Receptor Isoforms
More
Biological Activity
Description
IC50 & Target
|
δ Opioid Receptor/DOR |
μ Opioid Receptor/MOR |
In Vitro
β-Endorphin, equine TFA (0, 0.6, 1.2 and 3 μM) inhibits the striatal dopamine release[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. .
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Adult Female Wistar rats[3]
-
Dosage:2 or 20 μg/kg
-
Administration:2 or 20 μg/kg; i.p., once
-
Result:Hindered the acquisition of shuttle avoidance learning and habituation of a rearing response to a tone at a dose of 20 μg/kg. Caused amnesia in the avoidance task with the pre- or post-training administration of 2 μg/kg and pre-training administration of 20 μg/kg.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3423.94 (free acid)
-
Formula C154H248N42O44S.xC2HF3O2
-
Color White to off-white
-
Sequence
Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln
-
Sequence Shortening
YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ
-
Structure Classification
-
Initial Source
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Domest Anim Endocrinol
Pilot study of β-endorphin concentrations in horses with pituitary pars intermedia dysfunction using a newly validated enzyme-linked immunosorbent assay. [Abstract]2025 Nov 26:95:106982. PMID: 41317409
Solvent & Solubility
In Vitro:
H2O : 100 mg/mL (Need ultrasonic)
Purity & Documentation
-
Data Sheet (271 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[2]. Niinistö KE, et al. Plasma levels of heat shock protein 72 (HSP72) and beta-endorphin as indicators of stress, pain and prognosis in horses with colic. Vet J. 2010 Apr;184(1):100-4. [Content Brief]
[3]. Izquierdo I. Effects of a low and a high dose of beta-endorphin on acquisition and retention in the rat. Behav Neural Biol. 1980 Dec;30(4):460-4. [Content Brief]
[4]. Loh HH, et al. beta-Endorphin in vitro inhibition of striatal dopamine release. Nature. 1976 Dec 9;264(5586):567-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
β-Endorphin, equine TFA Related Classifications
HY-P1866A Related Classifications
Powered by Bioz