Hongotoxin-1
Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1, Kv1.2, Kv1.3, and Kv1.6 of 31 pM, 170 pM, 86 pM,and 6000 pM, respectively.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C181H299N53O49S7
- Masse moléculaire:4226.13
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Protocole
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
Description
IC50 & Target
|
Kv1.1 31 pM (IC50) |
Kv1.2 170 pM (IC50) |
Kv1.3 86 pM (IC50) |
Kv1.6 6000 pM (IC50) |
Chemical Information
-
Masse moléculaire 4226.13
-
Formule C181H299N53O49S7
-
Sequence
Thr-Val-Ile-Asp-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Ile-Arg-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His (Disulfide bridge:Cys3-Cys17;Cys10-Cys21;Cys16-Cys32)
-
Sequence Shortening
TVIDVKCTSPKQCLPPCKAQFGIRAGAKCMNGKCKCYPH (Disulfide bridge:Cys3-Cys17;Cys10-Cys21;Cys16-Cys32)
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocole
-
Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Hongotoxin-1 Related Classifications
HY-P3014 Related Classifications
Powered by Bioz