Margatoxin
Based on 1 publication(s) in Google Scholar
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 99.17%
- CAS No.: 145808-47-5
- Formule: C178H286N52O50S7
- Masse moléculaire:4178.95
-
Stockage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
-
Solvant et solubilité
- Pureté et documentation
- Références
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) Margatoxin
More
Activité biologique
Kd: 11.7 pM (Kv1.3), 6.4 pM (Kv1.2) and 4.2 nM (Kv1.1)[1]
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 145808-47-5
-
Appearance Solid
-
Masse moléculaire 4178.95
-
Formule C178H286N52O50S7
-
Color White to off-white
-
Sequence
Thr-Ile-Ile-Asn-Val-Lys-Cys-Thr-Ser-Pro-Lys-Gln-Cys-Leu-Pro-Pro-Cys-Lys-Ala-Gln-Phe-Gly-Gln-Ser-Ala-Gly-Ala-Lys-Cys-Met-Asn-Gly-Lys-Cys-Lys-Cys-Tyr-Pro-His (Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
-
Sequence Shortening
TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH(Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36)
-
Structure Classification
-
Initial Source
Centruroides margaritatus
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Cell Death Discov
Therapeutic potential of voltage-dependent potassium channel subtype 1.3 blockade in alleviating macrophage-related renal inflammation and fibrogenesis. [Abstract]2025 May 5;11(1):218. PMID: 40324999
Solvant et solubilité
DMSO : ≥ 2 mg/mL (0.48 mM; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
* "≥" means soluble, but saturation unknown.
Pureté et documentation
-
Fiche technique (294 KB)
-
SDS (393 KB)
- English - EN (393 KB)
- Français - FR (393 KB)
- Deutsch - DE (393 KB)
- Norwegian - NO (393 KB)
- Español - ES (393 KB)
- Swedish - SV (393 KB)
- Italian - IT (393 KB)
- Korean - KR (393 KB)
- Portuguese - PT (393 KB)
-
Instruction de manipulation (2659 KB)
Références
[1]. Bartok A, et al. Margatoxin is a non-selective inhibitor of human Kv1.3 K+ channels. Toxicon. 2014 Sep;87:6-16. [Content Brief]
[2]. Chen YC, et al. PreImplantation factor prevents atherosclerosis via its immunomodulatory effects without affecting serum lipids. Thromb Haemost. 2016 May 2;115(5):1010-24. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Margatoxin Related Classifications
HY-P1280 Related Classifications
Powered by Bioz