β-defesin 1 (pig)
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Formule: C180H313N59O50S9
- Masse moléculaire:4392.36
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Activité biologique
IC50: bacterial[1]
In a northern blot analysis, β-defesin 1 (pig) mRNA only expresses in ongue epithelial tissues from 4-5 week old pigs[1].In RT-PCR analysis, β-defesin 1 (pig) message throughout the epithelia of the respiratory (from nasal septum to lung) and gastrointestinal (from esophagus to rectum) tracts. In addition, it is detected in thymus, spleen, lymph node, brain, liver, kidney, urinary bladder, testis, skin, heart, muscle, bone marrow, alveolar macrophages, peripheral blood neutrophils and the umbilical cord. The only cells evaluated that does not express β-defesin 1 (pig) are peripheral blood mononuclear cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Masse moléculaire 4392.36
-
Formule C180H313N59O50S9
-
Synonyms
pBD-1
-
Sequence
Asn-Ile-Gly-Asn-Ser-Val-Ser-Cys-Leu-Arg-Asn-Lys-Gly-Val-Cys-Met-Pro-Gly-Lys-Cys-Ala-Pro-Lys-Met-Lys-Gln-Ile-Gly-Thr-Cys-Gly-Met-Pro-Gln-Val-Lys-Cys-Cys-Lys-Arg-Lys (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6）
-
Sequence Shortening
NIGNSVSCLRNKGVCMPGKCAPKMKQIGTCGMPQVKCCKRK (disulfide bridge:Cys1-Cys5,Cys2-Cys4,Cys3-Cys6）
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
β-defesin 1 (pig) Related Classifications
HY-P2289 Related Classifications
Powered by Bioz