cCBD-LL37
cCBD-LL37 is a chimeric antimicrobial peptide modified with a collagen-binding domain (cCBD) (TKKTLRT). cCBD-LL37 has improved retention on collagen after PBS washing and varying electrostatic conditions. cCBD-LL37 binds to collagen involves both specific and non-specific interactions, initiated by long-range electrostatic forces that transitions to close range or hydrophobic interactions. cCBD-LL37 has potent antimicrobial activity with improved structural stability under different ionic strengths and pH conditions (pH 5.5-8). cCBD-LL37 can be used for biomaterials like collagen-based wound dressings research.
For research use only. We do not sell to patients.
- CAS No.: 2378579-44-1
- Formula: C282H466N82O82
- Molecular Weight:6317.22
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
Chemical Information
-
CAS No. 2378579-44-1
-
Molecular Weight 6317.22
-
Formula C282H466N82O82
-
Sequence
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-Thr-Lys-Lys-Thr-Leu-Arg-Thr
-
Sequence Shortening
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Research Protocol for Infectious Diseases
Infectious-disease experiments test how pathogens interact with host barriers, innate immune receptors, inflammatory signaling, pathogen replication, and tissue injury; pattern-recognition receptors such as TLRs, RIG-I-like receptors, NOD-like receptors, and inflammasomes detect microbial molecules and activate NF-κB, interferon, and cytokine responses. The central hypothesis is that infection severity reflects the balance between pathogen burden and host response: protective inflammation restricts pathogen growth, whereas excessive or mislocalized inflammation contributes to tissue damage and disease phenotype. Unresolved questions include which host pathways are protective versus pathogenic, why some infection models fail to translate to human disease, and which combined readouts best predict clinically relevant infection outcomes.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)