cCBD-LL37
cCBD-LL37 is a chimeric antimicrobial peptide modified with a collagen-binding domain (cCBD) (TKKTLRT). cCBD-LL37 has improved retention on collagen after PBS washing and varying electrostatic conditions. cCBD-LL37 binds to collagen involves both specific and non-specific interactions, initiated by long-range electrostatic forces that transitions to close range or hydrophobic interactions. cCBD-LL37 has potent antimicrobial activity with improved structural stability under different ionic strengths and pH conditions (pH 5.5-8). cCBD-LL37 can be used for biomaterials like collagen-based wound dressings research.
For research use only. We do not sell to patients.
- CAS No.: 2378579-44-1
- Formula: C282H466N82O82
- Molecular Weight:6317.22
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Chemical Information
-
CAS No. 2378579-44-1
-
Molecular Weight 6317.22
-
Formula C282H466N82O82
-
Sequence
Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys-Thr-Lys-Lys-Thr-Leu-Arg-Thr
-
Sequence Shortening
LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
cCBD-LL37 Related Classifications
HY-P11457 Related Classifications
Powered by Bioz