Cecropin B free acid
Based on 1 publication(s) in Google Scholar
Cecropin B (free acid) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.
For research use only. We do not sell to patients.
- CAS No.: 203265-23-0
- Formula: C176H301N51O42S
- Molecular Weight:3835.65
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications Citing Use of MedChemExpress (MCE) Cecropin B free acid
More-
RT-PCR
Biological Activity
Chemical Information
-
CAS No. 203265-23-0
-
Molecular Weight 3835.65
-
Formula C176H301N51O42S
-
Sequence
Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu
-
Sequence Shortening
KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
PeerJ
A novel cecropin B-derived peptide with antibacterial and potential anti-inflammatory properties. [Abstract]2018 Jul 25:6:e5369. PMID: 30065898
Cecropin B free acid purchased from MedChemExpress. Usage Cited in: PeerJ. 2018 Jul 25:6:e5369. [Abstract]
Effects of Cecropin B and Cecropin DH on mRNA levels of inflammatory cytokines in 200 ng/mL LPS-stimulated RAW264.7 cells. Total RNA is analyzed for the expression of TNF-α, IL-1β, iNOS, MIP-1, MIP-2, IL-6 and GAPDH (loading control) by RT-PCR.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)