Nesiritide
Based on 1 Customer Validation
Nesiritide (Brain Natriuretic Peptide-32 human) is a recombinant human B-type natriuretic peptide. Nesiritide is a NPRs agonist, with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide regulates V1/2 activation/inactivation of the L-type calcium channel. Nesiritide shows vasodilatory, diuretic, and natriuretic activities. Nesiritide is used in cardiovascular diseases such as heart failure and vascular remodeling after arterial injury.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 99.75%
- CAS. Nr.: 124584-08-3
- Formel: C143H244N50O42S4
- Molecular Weight:3464.04
-
Speicherung:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Alle Calcium Channel Isoform-spezifische Produkte anzeigen
More
Biologische Aktivität
Beschreibung
IC50 & Target
Kd: 7.3 Pm (NPR-A), 13 pM (NPR-C)[1].
In Vitro
Nesiritide (1 nM-1 μM) significantly decreases cell shortening in ventricular myocytes isolated from rat hearts in a dose-dependent manner[1].
Nesiritide (1 μM) increases the V1/2 activation of the L-type calcium channel by 51.1% and decreases V1/2 inactivation by 31.8% in ventricular myocytes isolated from rat hearts[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
Nesiritide (0.1 mg/kg/day; s.c.; once daily; 4 weeks) protects endothelial function after balloon-induced trauma in the iliac artery in rabbits[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male rabbits (weight 2.3 kg, median age 5 months) with iliac artery endothelial trauma[3]
-
Dosage:0.1 mg/kg/day (diluted with normal saline)
-
Administration:Subcutaneous injection, once daily for 4 weeks
-
Result:Inhibited remodeling of rabbit iliac artery following endothelial trauma.
Reduced plasma levels of ET-1 and vWF.
Increased plasma level of NO, and decreased the ratio of PCNA positive expression.
Chemical Information
-
CAS. Nr. 124584-08-3
-
Appearance Solid
-
Molecular Weight 3464.04
-
Formel C143H244N50O42S4
-
Color White to off-white
-
Synonyms
Brain Natriuretic Peptide-32 human; BNP-32
-
Sequence
Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge: Cys10-Cys26)
-
Sequence Shortening
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys10-Cys26)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Lösungsmittel & Löslichkeit
In Vitro:
H2O : 100 mg/mL (28.87 mM; Need ultrasonic)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
In Vivo:
For the following dissolution methods, please prepare the working solution directly:
It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: PBS
Solubility: 100 mg/mL (28.87 mM); Clear solution; Need ultrasonic
Reinheit & Dokumentation
-
Data Sheet (272 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Sodi R, et al. B-type natriuretic peptide (BNP) attenuates the L-type calcium current and regulates ventricular myocyte function. Regul Pept. 2008 Nov 29;151(1-3):95-105. [Content Brief]
[2]. Lazar HL, et al. Nesiritide enhances myocardial protection during the revascularization of acutely ischemic myocardium. J Card Surg. 2009 Sep-Oct;24(5):600-5. [Content Brief]
[4]. Liu SQ, et al. Treatment with nesiritide, a recombinant B-type natriuretic Peptide, reduces vascular remodeling following balloon-induced endothelial injuries in rabbits. Tohoku J Exp Med. 2010 Nov;222(3):219-23. [Content Brief]
[5]. Liu SQ, et al. Recombinant B-type natriuretic peptide nesiritide attenuates vascular remodelling by reducing plasma aldosterone in rabbits. Heart Lung Circ. 2012 Sep;21(9):551-5. [Content Brief]
[6]. Hobbs RE, et al. Therapeutic potential of nesiritide (recombinant b-type natriuretic peptide) in the treatment of heart failure. Expert Opin Investig Drugs. 1999 Jul;8(7):1063-72. [Content Brief]
[7]. Koller KJ, et al. Molecular biology of the natriuretic peptides and their receptors. Circulation. 1992 Oct;86(4):1081-8. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2887 mL | 1.4434 mL | 2.8868 mL | 7.2170 mL |
| 5 mM | 0.0577 mL | 0.2887 mL | 0.5774 mL | 1.4434 mL | |
| 10 mM | 0.0289 mL | 0.1443 mL | 0.2887 mL | 0.7217 mL | |
| 15 mM | 0.0192 mL | 0.0962 mL | 0.1925 mL | 0.4811 mL | |
| 20 mM | 0.0144 mL | 0.0722 mL | 0.1443 mL | 0.3609 mL | |
| 25 mM | 0.0115 mL | 0.0577 mL | 0.1155 mL | 0.2887 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.