Beinaglutide
Based on 1 publication(s) in Google Scholar
Beinaglutide is a human GLP-1 polypeptide that shares almost 100% homology with human GLP-1 (7–36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH).
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 98.49%
- CAS. Nr.: 123475-27-4
- Formel: C149H225N39O46
- Molecular Weight:3298.61
-
Speicherung:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications Citing Use of MedChemExpress (MCE) Beinaglutide
More
Biologische Aktivität
Beinaglutide (100 nM; 48 h) increases the expression of phosphorylation of Akt in the adipocytes that were potentiated insulin-stimulated[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Cell Line:3T3L-1 cells
-
Concentration:100 nM
-
Incubation Time:48 h
-
Result:Increased the phosphorylation of Akt in the adipocytes that were potentiated insulin-stimulated.
Beinaglutide (150 μg/kg; s.c.; daily for 6 weeks) increases insulin sensitivity of adipocytes[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Wild-type male C57BL/6 mice and Male Lepob/Lepob (ob/ob) mice (ob/ob-NASH mouse model was induced by GAN diet)[1]
-
Dosage:0.6, 1.2, 2.4 mg/kg
-
Administration:S.c.; three times per day for 7 consecutive days
-
Result:Significantly reduced blood glucose with dosedependence in C57BL/6 and ob/ob mice, dose dependently inhibits food intake and gastric Emptying, and significantly reduced body weight, food intake with dose-dependence.
-
Animal Model:Eight-week-old male C57BL/6 mice[2]
-
Dosage:150 µg/kg
-
Administration:S.c.; daily for 6 weeks
-
Result:Showed improved glucose tolerance and insulin sensitivity, decreased adipose tissue weight and adipocyte size and potentiated insulin sensitivity of adipocytes.
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS. Nr. 123475-27-4
-
Appearance Solid
-
Molecular Weight 3298.61
-
Formel C149H225N39O46
-
Color White to off-white
-
Synonyms
GLP-1 (human)
-
Sequence Shortening
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Publications (1)
-
Journal Impact Factor
-
Most Recent
Lösungsmittel & Löslichkeit
DMSO : 1.79 mg/mL (0.54 mM; ultrasonic and adjust pH to 5 with HCl; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Reinheit & Dokumentation
-
Data Sheet (269 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. Fang X, et al. Beinaglutide shows significantly beneficial effects in diabetes/obesity-induced nonalcoholic steatohepatitis in ob/ob mouse model. Life Sci. 2021 Apr 1;270:118966. [Content Brief]
[2]. Zhang F, et al. Recombinant human GLP-1 beinaglutide regulates lipid metabolism of adipose tissues in diet-induced obese mice. iScience. 2021 Oct 30;24(12):103382. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)