FRETS-VWF73
Based on 1 publication(s) in Google Scholar
FRETS-VWF73, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex = 340 nm; Em = 450 nm). FRETS-VWF73 is a predictive tool for thrombotic thrombocytopenic purpura.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit : 97.30%
- Formel: C370H583N103O113S
- Molecular Weight:8314.28
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) FRETS-VWF73
More
Biologische Aktivität
Beschreibung
In Vitro
Guidelines (The following are our recommended solutions. These are only guidelines and should be modified according to your specific needs)
1.1 Preparation of storage solution
FRETS-VWF73 is dissolved in DMSO to prepare 1 mM FRETS-VWF73 stock solution.
Note: FRETS-VWF73 stock solution is recommended to be aliquoted and stored at -20°C or -80°C in the dark.
1.2 Preparation of working solution
Dilute the FRETS-VWF73 stock solution to 4 μM with assay buffer.
Note: Please adjust the concentration of FRETS-VWF73 working solution according to the actual situation, and prepare it fresh each time you use it.
1.3 Experimental procedures
1) Pooled human plasma (a range of 0-8 μL as a standard), or 4 μL of each test plasma, is diluted in 100 μL of assay buffer (5 mmol/L Bis-Tris, 25 mmol/L CaCl2, 0.005% Tween-20, pH 6) in a 96-well white plate.
2) Then, 100 μL of 4 μM FRETS-VWF73 in the assay buffer is added to each well.
3) Fluorescence is measured at 30℃ in a Wallac 1420 ARVO multilabel counter equipped with a 340-nm excitation filter and a 450-nm emission filter.
4) Fluorescence is measured every 5 min. The reaction rate is calculated by linear regression analysis of fluorescence over time from 0 to 60 min using the prism software.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. .
Chemical Information
-
Appearance Solid
-
Molecular Weight 8314.28
-
Formel C370H583N103O113S
-
Color Light yellow to yellow
-
Sequence
Asp-Arg-Glu-{Dap(Nma)}-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-{Dap(Dnp)}-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr-Leu-Pro-Arg-Glu-Ala-Pro-Asp-Leu-Val-Leu-Gln-Arg
-
Sequence Shortening
DRE-{Dap(Nma)}-APNLVYMVTG-{Dap(Dnp)}-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Blood
2026 May 28;147(22):2682-2696. PMID: 41557908
Lösungsmittel & Löslichkeit
In Vitro:
DMSO : 25 mg/mL (3.01 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Reinheit & Dokumentation
-
Data Sheet (307 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.1203 mL | 0.6014 mL | 1.2027 mL | 3.0069 mL |