1. Recombinant Proteins
  2. Immune Checkpoint Proteins CAR-T Related Proteins CD Antigens Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  4. B7-H3 B7-H3/CD276
  5. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (Biotinylated, HEK293, His-Avi)

CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78074
Handling Instructions Technical Support

CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD276/B7-H3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CD276/B7-H3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The CD276/B7-H3 protein is suggested to play a multifaceted role in the regulation of T-cell-mediated immune responses, potentially acting as a protective factor in tumor cells by inhibiting natural-killer-mediated cell lysis and serving as a marker for the detection of neuroblastoma cells. Additionally, CD276/B7-H3 may be involved in the development of acute and chronic transplant rejection, contributing to the regulation of lymphocytic activity at mucosal surfaces. Notably, it could play a crucial role in providing the placenta and fetus with an immunologically suitable environment throughout pregnancy. Both isoform 1 and isoform 2 of CD276/B7-H3 appear redundant in their ability to modulate CD4 T-cell responses, with isoform 2 demonstrated to enhance the induction of cytotoxic T-cells and selectively stimulate interferon-gamma production in the presence of T-cell receptor signaling. The interaction with TREML2 is identified as enhancing T-cell activation, highlighting the diverse roles CD276/B7-H3 may play in immune regulation and cellular responses.

Biological Activity

1. Immobilized Biotinylated Human B7-H3 (4Ig) His at 1 μg/mL (100 μL/Well) on the plate. Dose response curve for Anti-B7-H3 Ab hFc with the EC50 ≤ 15.2 ng/mL determined by ELISA.
2. Immobilized Anti-B7-H3 Antibody, hFc Tag at 0.5 or 2 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human B7-H3 (4Ig) , His Tag with the EC50 ≤10.5 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

Q5ZPR3-1 (G27-T461)

Gene ID
Molecular Construction
N-term
CD276 (G27-T461)
Accession # Q5ZPR3-1
8*His-Avi
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
B7-H3; CD276; PSEC0249;  4Ig-B7-H3; UNQ309; PRO352; B7 homolog 3; CD276
AA Sequence

GALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMT

Predicted Molecular Mass
49.5 kDa
Molecular Weight

Approximately 65-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5-8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78074
Quantity:
MCE Japan Authorized Agent: