IL-20 Protein, Human
Based on 1 publication(s) in Google Scholar
IL-20 Protein, Human is a member of the IL-10 family of cytokines. Interleukin-20 binds to the IL-20 heterodimeric receptor with a Kd of 1.5 nM.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-20 Protein, Human is a member of the IL-10 family of cytokines. Interleukin-20 binds to the IL-20 heterodimeric receptor with a Kd of 1.5 nM.
Background
Overexpression of Interleukin-20 (IL-20) in transgenic (TG) mice causes neonatal lethality with skin abnormalities including aberrant epidermal differentiation. Recombinant IL-20 protein stimulates a signal transduction pathway through STAT3 in a keratinocyte cell line, demonstrating a direct action of this ligand. An IL-20 receptor is identified as a heterodimer of two orphan class II cytokine receptor subunits[1].
Verified Bioactivity
The ED50 is <0.5 ng/mL as measured by murine BaF3 pro-B cells, corresponding to a specific activity of >2.0 × 106 units/mg.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Sci Signal
The E3 ligase TRIM21 promotes progression of pancreatic ductal adenocarcinoma by down-regulating TAp63α and derepressing IL20RB. [Abstract]2025 Jun 3;18(889):eadv4579. PMID: 40460193
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9NYY1-1 (L25-E176)
-
Molecular Construction
-
N-term
-
IL-20 (L25-E176)
Accession # Q9NYY1-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IL20; Cytokine Zcyto10; Interleukin 20; Interleukin-20; ZCYTO10; Interleukin Family Protein; IL-20; Four Alpha Helix Cytokine; IL10D
-
AA Sequence
LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
-
Predicted Molecular Mass
17.7 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized after extensive dialysis against PBS, pH 7.2, with trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)