1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-20
  5. IL-20 Protein, Rat

IL-20 Protein, a pivotal immune regulatory cytokine, critically modulates immune responses. IL-20 Protein, Rat is the recombinant rat-derived IL-20 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-20 Protein, a pivotal immune regulatory cytokine, critically modulates immune responses. IL-20 Protein, Rat is the recombinant rat-derived IL-20 protein, expressed by E. coli , with tag free.

Background

IL-20 Protein is an immune regulatory cytokine that plays a crucial role in modulating immune responses.

Biological Activity

Mouse IL20RA (HY-P77965) immobilized on CM5 Chip can bind Rat IL20 with an affinity constant of 761.1nM as determined in a SPR assay.

  • Mouse IL20RA (HY-P77965) immobilized on CM5 Chip can bind Rat IL20 with an affinity constant of 761.1nM as determined in a SPR assay.
Species

Rat

Source

E. coli

Tag

Tag Free

Accession

B8K1Y1 (L25-L176)

Gene ID

/

Molecular Construction
N-term
IL-20 (L25-L176)
Accession # B8K1Y1
C-term
Protein Length

Partial

Synonyms
Cytokine Zcyto10; IL10D; IL20; Interleukin-20
AA Sequence

LKTLHLGSCVITANLQAIQKEFSEIRHSVQAEDENIDVRILRTTESLKDTKLSDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFTELELQAAVVKALGELGILLRWMKQML

Predicted Molecular Mass
17.6 kDa
Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity
  • ≥ 85%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 0.2% SKL.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-20 Protein, Rat Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-20 Protein, Rat

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-20 Protein, Rat
Cat. No.:
HY-P73892
Quantity:
MCE Japan Authorized Agent: