IL-20 Protein, Rat
Based on 1 Customer Validation
IL-20 Protein, a pivotal immune regulatory cytokine, critically modulates immune responses. IL-20 Protein, Rat is the recombinant rat-derived IL-20 protein, expressed by E. coli , with tag free.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
IL-20 Protein, a pivotal immune regulatory cytokine, critically modulates immune responses. IL-20 Protein, Rat is the recombinant rat-derived IL-20 protein, expressed by E. coli , with tag free.
IL-20 Protein is an immune regulatory cytokine that plays a crucial role in modulating immune responses.
Mouse IL20RA (HY-P77965) immobilized on CM5 Chip can bind Rat IL20 with an affinity constant of 761.1nM as determined in a SPR assay.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
B8K1Y1 (L25-L176)
-
Gene ID/
-
Molecular Construction
-
N-term
-
IL-20 (L25-L176)
Accession # B8K1Y1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IL20; Cytokine Zcyto10; Interleukin 20; Interleukin-20; ZCYTO10; Interleukin Family Protein; IL-20; Four Alpha Helix Cytokine; IL10D
-
AA Sequence
LKTLHLGSCVITANLQAIQKEFSEIRHSVQAEDENIDVRILRTTESLKDTKLSDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFTELELQAAVVKALGELGILLRWMKQML
-
Predicted Molecular Mass
17.6 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 0.2% SKL.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
