FGF-21 Protein, Mouse

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

FGF-21 Protein, Mouse emerges as a metabolic hormone involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

FGF-21 Protein, Mouse emerges as a metabolic hormone involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism.

Background

Fibroblast growth factor (FGF) 21 is a member of the FGF superfamily. It is most closely related to FGF19 and FGF23, sharing 30–35% amino acid sequence homology. The FGF19 subfamily comprises FGF19, FGF21, and FGF23, and all three FGF19 subfamily members have recently emerged as metabolic hormones involved in the regulation of glucose, lipid, bile acid, and phosphate metabolism[1]. FGF21 provides sustained glucose and lipid control, amelioration of insulin resistance, improvements in β-cell function and mass, and beneficial changes in other lipoprotein and cardiovascular risk factor profiles[2].

Verified Bioactivity

1. The ED50 is <0.5 μg/mL as measured by a cell proliferation assay using NIH-3T3 cells in the presence of 1.25 µg/mL mouse Klotho and 10.0 µg/mL heparin, corresponding to a specific activity of >2.0 × 103 units/mg.
2. Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is ≤1.001 μg/mL in the presence of 1 μg/mL Recombinant Human Klotho beta, corresponding to a specific activity is ≥ 989.12 units/mg.
3. Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.153 μg/mL in the presence of 1.25 μg/mL Recombinant Mouse Klotho beta, corresponding to a specific activity is 867.303 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using NIH‑3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 1.001 μg/mL in the presence of 1 μg/mL Recombinant Human Klotho beta, corresponding to a specific activity is 989.12 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FGF-21 (A29-S210)
      Accession # Q9JJN1
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF21; FGF-21; Fibroblast Growth Factor 21; FGF; Fibroblast Growth Factor

  • AA Sequence

    AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

  • Predicted Molecular Mass

    20 kDa

  • Molecular Weight

    Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00