S100A9 Protein, Human

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

S100A9 Protein is an acidic protein. S100A9 Protein activates pro-inflammatory signaling pathways by binding to TLR4/MD2 and RAGE receptors, regulating transcription factors such as NF-κB, CREB-1, STAT3/STAT5, etc. S100A9 Protein forms a heterodimer (calprotectin) with S100A8. S100A9 Protein enhances cytokine secretion under inflammatory stimulation, promotes immune cell migration, regulates vascular endothelial permeability, induces tumor cell apoptosis, and exerts antibacterial effects through metal ion chelation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

S100A9 Protein is an acidic protein. S100A9 Protein activates pro-inflammatory signaling pathways by binding to TLR4/MD2 and RAGE receptors, regulating transcription factors such as NF-κB, CREB-1, STAT3/STAT5, etc. S100A9 Protein forms a heterodimer (calprotectin) with S100A8. S100A9 Protein enhances cytokine secretion under inflammatory stimulation, promotes immune cell migration, regulates vascular endothelial permeability, induces tumor cell apoptosis, and exerts antibacterial effects through metal ion chelation.

Background

S100A9 protein belongs to the S100 calcium-binding protein family. The members of this family contain EF-hand domains and have calcium-dependent regulatory functions[3][7]. S100A9 protein is an acidic protein expressed by myeloid cells such as monocytes and neutrophils. It often forms a heterodimer with S100A8 (calprotectin) and participates in inflammation, immunity and host defense processes[1][2][5]. S100A9 Protein activates pro-inflammatory signaling pathways by binding to TLR4/MD2 and RAGE receptors, regulates transcription factors such as NF-κB, CREB-1, STAT3/STAT5, and affects the secretion of cytokines (such as IL-8); regulates cytoskeleton reorganization by interacting with tubulin, and promotes transendothelial migration of phagocytes; and can also exert antibacterial activity or induce tumor cell apoptosis by chelating zinc ions[1][4][5][6][7]. S100A9 Protein is mainly expressed in the cytoplasm of neutrophils and monocytes. It can be secreted outside the cells under inflammatory conditions and enriched on the surface of endothelial cells and in body fluids at the site of inflammation[1][5][7]. S100A9 Protein, Human is highly conserved in amino acid sequence and function with its homologous proteins in other species such as mice. Both proteins mediate biological effects through calcium/zinc ion-dependent conformational changes, but some regulatory sites (such as the lack of Thr113 phosphorylation site in mouse S100A9) differ[4][7]. S100A9 Protein, Human consists of 119 amino acids with a molecular weight of approximately 14 kDa. It contains two EF-hand calcium-binding domains and can form homodimers or heterodimers with S100A8. Its activity depends on the cooperative binding of calcium/zinc ions and phosphorylation modification by kinases such as p38 MAPK[1][4][7]. S100A9 Protein, Human Enhances cytokine secretion under inflammatory stimulation, promotes immune cell migration, regulates vascular endothelial permeability, induces tumor cell apoptosis, and exerts antibacterial effects through metal ion chelation[1][5][6][7].

In Vitro

S100A9 Protein, Human (10 μg/mL; 30 min) can enhance fMLP- or GM-CSF-stimulated IL-8 production by activating transcription factors such as NF-κB and CREB-1[1].
S100A9 Protein, Human (1.25-10 μM; 1-4 d) induces apoptosis in MM46 mouse breast cancer cells[6].

Verified Bioactivity

1.Measured by its ability to induce CXCL1/KC secretion by C3H/10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is 1.616 - 3.731 μg/mL.
2.Immobilized Recombinant Human S100A9 at 2 μg/mL (100 μL/well) can bind Anti-Human S100A9 Antibody. The ED50 of Anti-Human S100A9 Antibody is 0.5-1.0 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to enhance CXCL1 secretion by C3H/10T1/2 Mouse embryonic fibroblasts. The ED50 for this effect is 3.295 μg/mL, corresponding to a specific activity is 303.4901 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • S100A9 (T2-P114)
      Accession # P06702
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100A9; 60B8AG; Prev. CAGB; CGLB; Prev. CFAG; MIF; MRP-14; NIF; MRP14; Protein S100-A9; P14; Calgranulin B; Migration Inhibitory Factor-Related Protein 14; S100 Calcium-Binding Protein A9 (Calgranulin B); Leukocyte L1 Complex Heavy Chain; S100 Calcium-Binding Protein A9; Calprotectin L1H Subunit; Calgranulin-B; S100-A9; L1AG; MAC387; S100 Calcium Binding Protein A9; LIAG

  • AA Sequence

    TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00