SAA1/Serum Amyloid A-1 Protein, Mouse (His)

Serum Amyloid A-1 Protein, a vital acute phase protein, primarily exists as a homohexamer composed of dimers of trimers.Although it can form amyloid fibrils after partial proteolysis, the native, undenatured form does not exhibit amyloid fibril formation in vitro.Serving as an apolipoprotein within the HDL complex, Serum Amyloid A-1 also shows affinity for heparin binding, highlighting its multifaceted role in biological processes.SAA1/Serum Amyloid A-1 Protein, Mouse (His) is the recombinant mouse-derived SAA1 protein, expressed by E.coli , with N-6*His labeled tag.

Serum Amyloid A-1 Protein emerges as a significant acute phase protein, existing primarily as a homohexamer composed of dimers of trimers. While it has the potential to form amyloid fibrils after partial proteolysis, it's noteworthy that the native, undenatured form of the protein does not exhibit amyloid fibril formation in vitro. Additionally, Serum Amyloid A-1 serves a crucial role as an apolipoprotein within the HDL complex and demonstrates affinity for heparin binding, underscoring its multifaceted nature in biological processes.

Measured by its ability to induce TNF-alpha secretion by J774A.1 mouse reticulum cell sarcoma macrophage cells. The ED ₅₀ for this effect is 4.689 μg/mL.

• 
  Measured by its ability to induce TNF-alpha secretion by J774A.1 mouse reticulum cell sarcoma macrophage cells. The ED₅₀ for this effect is 4.689 μg/mL. Corresponding to a specific activity is 213.265 U/mg.

Mouse

E. coli

N-6*His

P05366 (G20-Y122)

20208  [NCBI]

Full Length of Mature Protein

GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY

Approximately 13-17 kDa

• 
  ≥ 85%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 Eu/ug, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/lovo-cell.html  [Content Brief]