Staphylokinase Protein, S. aureus
Based on 1 Customer Validation
Staphylokinase Protein efficiently converts plasminogen into active plasmin, a key enzyme in fibrinolysis. It forms a 1:1 complex with plasmin, activating additional plasminogen molecules and amplifying the fibrinolytic cascade. Staphylokinase Protein, S. aureus is the recombinant Staphylococcus aureus-derived Staphylokinase protein, expressed by E. coli , with tag free.
- Species: Staphylococcus aureus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Staphylokinase Protein efficiently converts plasminogen into active plasmin, a key enzyme in fibrinolysis. It forms a 1:1 complex with plasmin, activating additional plasminogen molecules and amplifying the fibrinolytic cascade. Staphylokinase Protein, S. aureus is the recombinant Staphylococcus aureus-derived Staphylokinase protein, expressed by E. coli , with tag free.
Background
Staphylokinase Protein is a potent plasminogen activator that efficiently converts plasminogen into plasmin, an active enzyme involved in fibrinolysis. It forms a 1:1 complex with plasmin, and this complex further activates additional plasminogen molecules, amplifying the fibrinolytic cascade.
Verified Bioactivity
The specific activity determined by fibrining lysis in agarose plate is >5.0 × 104 IU/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Staphylococcus aureus
-
Source E. coli
-
Tag Tag Free
-
Accession
P68802 (S28-K163)
-
Gene ID58067813
-
Molecular Construction
-
N-term
-
Staphylokinase (S28-K163)
Accession # P68802 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PLK4; Non-Specific Serine/Threonine Protein Kinase; Prev. STK18; Polo-Like Kinase 4 (Drosophila); Serine/Threonine-Protein Kinase PLK4; Serine/Threonine Kinase 18; Polo-Like Kinase 4; Snk Akin Kinase; Sak; MCCRP2; Serine/Threonine-Protein Kinase Sak; PLK-4; Serine/Threonine-Protein Kinase 18; SAK; Polo Like Kinase 4; Serine/Threonine-Protein Kinase SAK
-
AA Sequence
SSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg; determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)