country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P11168

Copy Link Print Information

Diptericin

Diptericin is an antibacterial peptide, originally isolated from Phormia terranovae. Diptericin exhibits potent and selective activity against specific Gram-negative bacteria, such as Escherichia coli and Salmonella typhimurium. Diptericin kills bacteria within 1 hour. Diptericin can be used for antibacterial research.

For research use only. We do not sell to patients.

Formula: C₁₇₃H₂₆₈N₅₀O₅₅
Molecular Weight:3928.28

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Diptericin Chemical Structure

Size

Price

Stock

Quantity

Sample (0.1mg)

In-stock

(In Japan)

Apply Now

Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability

Bulk Inquiry

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Chemical Information

Molecular Weight 3928.28
Formula C₁₇₃H₂₆₈N₅₀O₅₅
Sequence

Asp-Leu-His-Ile-Pro-Pro-Pro-Asp-Asn-Lys-Ile-Asn-Trp-Pro-Gln-Leu-Ser-Gly-Gly-Gly-Gly-Gly-Ser-Pro-Lys-Thr-Gly-Tyr-Asp-Ile-Asn-Ile-Asn-Ala-Gln-Gln-Lys
Sequence Shortening

DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (257 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Cudic M, et al. Chemical synthesis, antibacterial activity and conformation of diptericin, an 82-mer peptide originally isolated from insects. Eur J Biochem. 1999 Dec;266(2):549-58. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock