Helospectin I
Helospectin I is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin I has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin I is originally isolated from the salivary gland venom of the lizard Heloderma suspectum.
Para uso exclusivo en investigación. No vendemos a pacientes.
- No. CAS: 93438-37-0
- Fòrmula: C183H293N47O59
- Peso molecular:4095.63
-
Almacenamiento:
Please store the product under the recommended conditions in the Certificate of Analysis.
Actividad biológica
Descripciòn
IC50 & Target
Vasoactive intestinal peptide (VIP)[1]
In Vitro
Helospectin I (suffusion at 0.1 nM, in bicarbonate buffer for 30 min) evokes significant, sustained and similar vasodilation in the intact hamster cheek pouch[1].
Helospectin I relaxes the Phenylephrine-contracted rat femoral arteries with pEC50 of 6.82[2].
Helospectin I (0.1 nM-1 μM) inhibits the binding of 125I-labeled VIP and 125I-secretin to dispersed chief cells[4].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. .
In Vivo
Helospectin I (0.1-0.8 nmol /kg, i.v.) increases plasma levels of glucagon in mice[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:SD rats[2]
-
Dosage:0.03, 0.3, 1, 2 nM/kg
-
Administration:100 μL of infusion at the left jugular vein, followed by washing the catheter with 100 μL saline.
-
Result:Reduced the blood pressure, but was less effective than vasoactive intestinal peptide (VIP) in the low dose range.
-
Animal Model:Mice[3]
-
Dosage:0.1, 0.2, 0.4, 0.8 nM /kg
-
Administration:Intravenous injection (i.v.)
-
Result:Markedly stimulated glucagon secretion, and had no direct action on insulin secretion.
Chemical Information
-
No. CAS 93438-37-0
-
Peso molecular 4095.63
-
Fòrmula C183H293N47O59
-
Sequence Shortening
HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureza y Documentación
Referencias
[1]. Tsueshita T, et al. Helospectin I and II evoke vasodilation in the intact peripheral microcirculation. Peptides. 2004 Jan;25(1):65-9. [Content Brief]
[2]. Grundemar L, et al. Vascular effects of helodermin, helospectin I and helospectin II: a comparison with vasoactive intestinal peptide (VIP). Br J Pharmacol. 1990 Mar;99(3):526-8. [Content Brief]
[3]. Ahrén B. Effects of helospectin I on insulin and glucagon secretion in the mouse. Br J Pharmacol. 1991 Apr;102(4):916-8. [Content Brief]
[4]. Rai A, et al. Actions of Helodermatidae venom peptides and mammalian glucagon-like peptides on gastric chief cells. Am J Physiol. 1993 Jul;265(1 Pt 1):G118-25. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)