SPIN4 Protein, Human
The SPIN4 protein exhibits H3K4me3 binding activity, demonstrating affinity for lysine 4 trimethylated histone H3. This unique combination suggests a role in recognizing specific chromatin modifications, potentially regulating gene expression or chromatin dynamics. SPIN4 Protein, Human is the recombinant human-derived SPIN4 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Almacenamiento:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Technical Parameters
-
Product Properties
- Documentación
- Help & FAQs
Actividad biológica
Descripciòn
The SPIN4 protein exhibits H3K4me3 binding activity, demonstrating affinity for lysine 4 trimethylated histone H3. This unique combination suggests a role in recognizing specific chromatin modifications, potentially regulating gene expression or chromatin dynamics. SPIN4 Protein, Human is the recombinant human-derived SPIN4 protein, expressed by E. coli , with tag free.
Background
SPIN4 protein showcases H3K4me3-binding activity, indicating its affinity for histone H3 trimethylated at lysine 4. This unique binding ability suggests a potential role for SPIN4 in recognizing specific chromatin modifications, implicating it in the regulation of gene expression or chromatin dynamics. Additionally, SPIN4 interacts with C11orf84/SPINDOC, indicating a potential partnership or functional association with this interacting protein. These molecular interactions underscore the intricate involvement of SPIN4 in epigenetic processes and protein-protein interactions, hinting at its potential significance in cellular regulation and chromatin-related functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q56A73 (S2-P249)
-
Gene ID139886
-
Molecular Construction
-
N-term
-
SPIN4 (S2-P249)
Accession # Q56A73 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SPIN4; FLJ44984; Spindlin Family Member 4; Spindlin Family, Member 4; TDRD28; LJBS; Spindlin-4
-
AA Sequence
SPPTVPPMGVDGVSAYLMKKRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQEPGEVVDSLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLVKTP
-
Pureza
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentación
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
