GHRF, porcine
GHRF, porcine is a growth hormone releasing factor (GHRF) peptide (porcine). GHRF binds to GHSR and induces the release of growth hormone.
For research use only. We do not sell to patients.
- CAS No.: 88384-73-0
- Formula: C219H365N73O66S
- Molecular Weight:5108.76
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
GHRF, porcine (50 pM) induces GH release in rat anterior pituitary cells[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Pigs[2]
-
Dosage:0.5 μg/kg
-
Administration:Intravenous injection (i.v.)
-
Result:Increased plasma concentrations of porcine somatotropin (pST) in control pigs, without any pST response in pST-treated pigs.
Chemical Information
-
CAS No. 88384-73-0
-
Molecular Weight 5108.76
-
Formula C219H365N73O66S
-
Sequence Shortening
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Vigh S, et al. Interaction between hypothalamic peptides in a superfused pituitary cell system. Peptides. 1984;5 Suppl 1:241-7. [Content Brief]
[2]. Klindt J, et al. Influence of porcine somatotropin administration and sex on glucose and endocrine responses in obese pigs. Proc Soc Exp Biol Med. 1994 Oct;207(1):48-56. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz