GLP-2(3-33)
Based on 3 publication(s) in Google Scholar
GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
For research use only. We do not sell to patients.
- Purity : 99.82%
- CAS No.: 275801-62-2
- Formula: C156H242N40O53S
- Molecular Weight:3557.89
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) GLP-2(3-33)
More
Biological Activity
Description
In Vitro
GLP-2 is secreted as a 33-amino acid peptide, but is rapidly degraded at an N-terminus site to GLP-2(3-33) in circulation, in large part, by dipeptidylpeptidase IV (DPPIV). GLP-2 (3-33) acts as a partial agonist with potential competitive antagonistic properties on the GLP-2 receptor. In the GLP-2 receptor-binding assay, the binding IC50 for GLP-2 1–33 was 3.1 nM, and it was 41 nM for GLP-2 3-33. Thus, GLP-2 3–33 had 7.5% binding affinity compared to GLP-2 1-33[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. .
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male C57BL/6J (B6) mice (HFD)[2]
-
Dosage:60 ng
-
Administration:Once a day i.p. for 4 weeks
-
Result:Significantly affected plasma lipids; Showed increase of triglycerides and cholesterol and reduction of HDL; Significantly increased plasma ALT and AST and intrahepatic lipid concentration.
Chemical Information
-
CAS No. 275801-62-2
-
Appearance Solid
-
Molecular Weight 3557.89
-
Formula C156H242N40O53S
-
Color White to off-white
-
Sequence Shortening
DGSFSDEMNTILDNLAARDFINWLIQTKITD
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Cell Mol Life Sci
Role of the GLP2-Wnt1 axis in silicon-rich alkaline mineral water maintaining intestinal epithelium regeneration in piglets under early-life stress. [Abstract]2024 Mar 12;81(1):126. PMID: 38470510 -
Mol Metab
High fructose rewires gut glucose sensing via glucagon-like peptide 2 to impair metabolic regulation in mice. [Abstract]2025 Mar:93:102101. PMID: 39855562 -
Solvent & Solubility
In Vitro:
H2O : 33.33 mg/mL (9.37 mM; ultrasonic and adjust pH to 10 with NH3·H2O)
DMSO : 33.33 mg/mL (9.37 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Purity & Documentation
-
Data Sheet (270 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Thulesen J, Knudsen LB, Hartmann B, Hastrup S, Kissow H, Jeppesen PB, Ørskov C, Holst JJ, Poulsen SS. The truncated metabolite GLP-2 (3-33) interacts with the GLP-2 receptor as a partial agonist. Regul Pept. 2002 Jan 15;103(1):9-15. [Content Brief]
[2]. Baldassano S, et al. Influence of endogenous glucagon-like peptide-2 on lipid disorders in mice fed a high-fat diet. Endocr Res. 2016 Nov;41(4):317-324. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O / DMSO | 1 mM | 0.2811 mL | 1.4053 mL | 2.8107 mL | 7.0266 mL |
| 5 mM | 0.0562 mL | 0.2811 mL | 0.5621 mL | 1.4053 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.