INF7TAT acetate
INF7TAT acetate is an amphipathic cell-penetrating peptide that mediates intracellular delivery of CRISPR ribonucleoproteins. INF7TAT acetate achieves endosomal escape via the INF7 fragment and cell binding via the TAT fragment. It enables intracellular delivery into primary human T cells and hematopoietic stem and progenitor cells, facilitating gene knockout and AAV-mediated homology-directed repair. INF7TAT acetate can be used for genome editing-related research.
For research use only. We do not sell to patients.
- Formula: C179H268N54O48S·xC2H4O2
- Molecular Weight:3976.44 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
In Vitro
INF7TAT acetate is the amphipathic peptide backbone of the PERC delivery system, and its engineered variants INF7TAT‑A5K / INF7TAT‑P55 enable efficient intracellular delivery of Cas9 RNP and Cas12a RNP into human primary T cells and human primary hematopoietic stem and progenitor cells (HSPC) without electroporation equipment[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
Chemical Information
-
Appearance Solid
-
Molecular Weight 3976.44 (free base)
-
Formula C179H268N54O48S·xC2H4O2
-
SMILES
O=C(N[C@@H](CC(C)C)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](CCC(O)=O)C(N[C@@H](C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CC2=CC=CC=C2)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(N)=O)C(NCC(N[C@@H](CC3=CNC4=CC=CC=C34)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCSC)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(O)=O)C(NCC(N[C@@H](CC5=CNC6=CC=CC=C56)C(N[C@@H](CC7=CC=C(C=C7)O)C(NCC(N[C@@H](CC8=CC=C(C=C8)O)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CN
-
Sequence
Gly-Leu-Phe-Glu-Ala-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg
-
Sequence Shortening
GLFEAIEGFIENGWEGMIDGWYGYGRKKRRQRR
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
In Vitro:
H2O : 25 mg/mL (Need ultrasonic)
Protocols
-
Gene Editing
Gene editing modify specific sites within the genome through gene deletions, insertions or conversions to study functionally unknown genes or conduct gene therapy. It is also used to change the biological traits of organisms to establish new varieties. Gene editing techniques include zinc finger nuclease (ZFN), transcription activator-like effector nuclease (TALEN), and clustered regularly interspaced short palindromic repeats (CRISPR)/CRISPR-associated protein 9 (Cas 9) (CRISPR/Cas9).
-
CRISPR-Cas9 knockout in cultured mammalian cells
CRISPR-Cas9 knockout in cultured mammalian cells uses an sgRNA to direct Cas9 to a complementary genomic sequence adjacent to a compatible PAM; Cas9 creates a targeted DNA double-strand break, and repair by non-homologous end joining can introduce insertions or deletions that disrupt the coding sequence or functional genomic element. The readout of knockout is detection of edited alleles and loss of gene product or phenotype, commonly by PCR/Sanger-sequence trace decomposition, targeted sequencing, immunoblotting, immunostaining, or flow cytometry when the target protein is detectable at the cell surface.
-
CRISPR-Cas9 HDR knock-in/precise editing
CRISPR-Cas9 HDR knock-in uses a guide RNA to direct Cas9 to a genomic target adjacent to a PAM, where Cas9 creates a double-strand break; if a donor DNA template with homology to the cut region is present, cellular HDR can copy the donor sequence into the genome, producing a precise substitution, tag, reporter, or insertion rather than an indel. The readout is the fraction of alleles or cells carrying the intended donor-derived edit, measured by junction PCR, restriction-fragment analysis, Sanger sequencing, amplicon deep sequencing, flow cytometry for reporter knock-in, or clone genotyping; NHEJ indels and partial or non-HDR insertions are measured in parallel because they compete with or confound precise HDR outcomes.
-
CRISPR-Cas9 zebrafish embryo editing
CRISPR-Cas9 zebrafish embryo editing introduces targeted double-strand breaks in genomic DNA by delivering Cas9 nuclease with a guide RNA into one-cell-stage embryos; repair by endogenous DNA-repair pathways produces indels or donor-mediated insertions that can be detected by phenotype, PCR-based genotyping, heteroduplex assays, Sanger sequencing, or amplicon sequencing. The readout reflects the frequency and spectrum of edited alleles in mosaic F0 embryos or transmitted F1 animals; because injected embryos can carry multiple alleles, founder screening and sequence confirmation are required before establishing stable mutant lines.
-
Constitutive Germline Knockout Model
Constitutive germline knockout models are generated by producing a heritable loss-of-function allele in the mouse genome, typically through complete gene disruption in embryonic stem (ES) cells followed by germline transmission or through CRISPR/Cas-mediated editing of zygotes, resulting in offspring that carry a stable null allele in all tissues. Classical approaches rely on homologous recombination in ES cells to introduce targeted gene disruptions, which are then transmitted through chimeric mice to the germline. More recent genome editing strategies use CRISPR/Cas systems to induce double-strand breaks and non-homologous end joining (NHEJ), frequently generating frameshift mutations that abolish gene function, enabling faster generation of knockout alleles directly in embryos. Germline transmission or direct germline editing ensures that the mutation is present in all cells of the resulting animal, allowing systemic functional analysis of gene loss.
-
CRISPR/Cas9 Knockout Animal Model
CRISPR/Cas9 knockout animal modeling uses guide RNA to direct Cas9 to a genomic target, where Cas9 creates a DNA double-strand break; repair by error-prone non-homologous end joining generates insertions or deletions that can disrupt coding sequence and produce knockout alleles. Classic animal-model workflows deliver Cas9 mRNA or Cas9 protein with sgRNA into fertilized zygotes by microinjection or electroporation, then transfer edited embryos into pseudopregnant recipients and genotype founders for target-site mutations.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)