INF7TAT acetate
INF7TAT acetate is an amphipathic cell-penetrating peptide that mediates intracellular delivery of CRISPR ribonucleoproteins. INF7TAT acetate achieves endosomal escape via the INF7 fragment and cell binding via the TAT fragment. It enables intracellular delivery into primary human T cells and hematopoietic stem and progenitor cells, facilitating gene knockout and AAV-mediated homology-directed repair. INF7TAT acetate can be used for genome editing-related research.
For research use only. We do not sell to patients.
- Formula: C179H268N54O48S·xC2H4O2
- Molecular Weight:3976.44 (free base)
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
-
Solvent & Solubility
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
In Vitro
INF7TAT acetate is the amphipathic peptide backbone of the PERC delivery system, and its engineered variants INF7TAT‑A5K / INF7TAT‑P55 enable efficient intracellular delivery of Cas9 RNP and Cas12a RNP into human primary T cells and human primary hematopoietic stem and progenitor cells (HSPC) without electroporation equipment[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Molecular Weight 3976.44 (free base)
-
Formula C179H268N54O48S·xC2H4O2
-
SMILES
O=C(N[C@@H](CC(C)C)C(N[C@@H](CC1=CC=CC=C1)C(N[C@@H](CCC(O)=O)C(N[C@@H](C)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CC2=CC=CC=C2)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(N)=O)C(NCC(N[C@@H](CC3=CNC4=CC=CC=C34)C(N[C@@H](CCC(O)=O)C(NCC(N[C@@H](CCSC)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CC(O)=O)C(NCC(N[C@@H](CC5=CNC6=CC=CC=C56)C(N[C@@H](CC7=CC=C(C=C7)O)C(NCC(N[C@@H](CC8=CC=C(C=C8)O)C(NCC(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCCN)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CCCNC(N)=N)C(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CN
-
Sequence
Gly-Leu-Phe-Glu-Ala-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Gly-Trp-Tyr-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg
-
Sequence Shortening
GLFEAIEGFIENGWEGMIDGWYGYGRKKRRQRR
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Solvent & Solubility
In Vitro:
H2O : 25 mg/mL (Need ultrasonic)
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
INF7TAT acetate Related Classifications
HY-P11000A Related Classifications
Powered by Bioz