Kaliotoxin
Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability.
For research use only. We do not sell to patients.
- CAS No.: 145199-73-1
- Formula: C171H283N55O49S8
- Molecular Weight:4149.94
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
IC50 & Target
Kd: 20 nM (KCa channel)[1]
In Vitro
Kaliotoxin (KTX) (250 nM) specifically suppressed the whole cell Ca2+-activated K+ current[1].
Kaliotoxin interacts in a one-to-one way with KCa channels with a Kd of 20 nM[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Further protocols information, click here.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male Sprague–Dawley rats (280–300 g)[2]
-
Dosage:10 ng
-
Administration:Intracerebroventricular injection
-
Result:Improved learning but not information consolidation.
Increased the long-term retrieval of an odour-reward association.
Chemical Information
-
CAS No. 145199-73-1
-
Molecular Weight 4149.94
-
Formula C171H283N55O49S8
-
Sequence
Gly-Val-Glu-Ile-Asn-Val-Lys-Cys-Ser-Gly-Ser-Pro-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Met-Asn-Arg-Lys-Cys-His-Cys-Thr-Pro-Lys (Disulfide bridge: Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
-
Sequence Shortening
GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bridge: Cys8-Cys28;Cys14-Cys33;Cys18-Cys35)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Fluorescent plasma-membrane potential dye assay
Fluorescent plasma-membrane potential dye assays measure changes in cell membrane potential using voltage-sensitive dyes whose fluorescence changes when cells depolarize or hyperpolarize. Anionic bis-oxonol dyes such as DiBAC4(3) enter depolarized cells more readily and show increased fluorescence after intracellular binding, while hyperpolarization reduces dye accumulation and fluorescence. FMP/FLIPR membrane-potential dyes are used for faster, homogeneous microplate assays of ion-channel or receptor-mediated membrane-potential changes.
Purity & Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. M Crest, et al. Kaliotoxin, a novel peptidyl inhibitor of neuronal BK-type Ca(2+)-activated K+ channels characterized from Androctonus mauretanicus mauretanicus venom. J Biol Chem. 1992 Jan 25;267(3):1640-7. [Content Brief]
[2]. S Kourrich, et al. Kaliotoxin, a Kv1.1 and Kv1.3 channel blocker, improves associative learning in rats. Behav Brain Res. 2001 Apr 8;120(1):35-46. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Kaliotoxin Related Classifications
HY-P1281 Related Classifications
Powered by Bioz