Kremen-2 Protein, Human (HEK293, His)
Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. Kremen-2 is positioned as a key regulator in the Wnt signaling pathway, regulating cellular responses to developmental cues. Kremen-2 Protein, Human (HEK293, His) is the recombinant human-derived Kremen-2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting the endocytosis of Wnt receptors LRP5 and LRP6. Kremen-2 is positioned as a key regulator in the Wnt signaling pathway, regulating cellular responses to developmental cues. Kremen-2 Protein, Human (HEK293, His) is the recombinant human-derived Kremen-2 protein, expressed by HEK293 , with C-His labeled tag.
Background
Kremen-2 Protein serves as a receptor for Dickkopf proteins and collaborates with DKK1/2 to inhibit Wnt/beta-catenin signaling by facilitating the endocytosis of Wnt receptors LRP5 and LRP6. This regulatory role in the Wnt signaling pathway positions Kremen-2 as a key modulator of cellular responses to developmental cues. In limb development, Kremen-2 plays a crucial role by attenuating Wnt signaling, contributing to normal limb patterning, and negatively regulating bone formation. Its interaction with ERLEC1 and formation of a ternary complex with DKK1 and LRP6 underscore the intricate molecular mechanisms through which Kremen-2 participates in the fine-tuning of Wnt signaling and developmental processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His
-
Accession
Q8NCW0-1 (G26-A364)
-
Molecular Construction
-
N-term
-
Kremen-2 (G26-A364)
Accession # Q8NCW0-1 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KREMEN2; Kringle Domain-Containing Transmembrane Protein 2; Kringle Containing Transmembrane Protein 2; Dickkopf Receptor 2; KRM2; Kremen Protein 2; Kringle-Containing Protein Marking The Eye And The Nose; MGC10791
-
AA Sequence
GSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPGAPPAA
-
Predicted Molecular Mass
37.1 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
