Myoregulin
Myoregulin (MLN peptide) is a member of the regulin family. Myoregulin regulates muscle performance by modulating intracellular calcium handling. Myoregulin interactes directly with sarcoplasmic reticulum Ca2+-ATPase (SERCA) and impedinf Ca2+ uptake into the sarcoplasmic reticulum.
For research use only. We do not sell to patients.
- Formula: C239H391N53O67S3
- Molecular Weight:5175.17
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
All Calcium Channel Isoforms
More
Biological Activity
Description
Chemical Information
-
Molecular Weight 5175.17
-
Formula C239H391N53O67S3
-
Synonyms
MLN peptide
-
Sequence
Met-Ser-Gly-Lys-Ser-Trp-Val-Leu-Ile-Ser-Thr-Thr-Ser-Pro-Gln-Ser-Leu-Glu-Asp-Glu-Ile-Leu-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Leu-Phe-Val-Asp-Leu-Met-Ser-Ile-Met-Tyr-Val-Val-Ile-Thr-Ser
-
Sequence Shortening
MSGKSWVLISTTSPQSLEDEILGRLLKILFVLFVDLMSIMYVVITS
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Calcium Spark Assay
Calcium sparks are localized, transient increases in intracellular calcium concentration ([Ca2+]i) that occur in cardiac myocytes and represent elementary events underlying excitation-contraction coupling. These events are generated by the coordinated opening of clusters of ryanodine receptors (RyRs) on the sarcoplasmic reticulum membrane, leading to a brief release of Ca2+ into the cytosol. The detection and analysis of calcium sparks provide insights into the mechanisms of calcium handling and signaling in cardiac cells. Imaging techniques using fluorescent calcium indicators such as Fluo-3 are employed to visualize these subcellular calcium transients with high spatial and temporal resolution. The protocol is based on established methodologies described in primary literature for both experimental measurement and automated analysis of calcium sparks.
-
Ca2+ Staining Technique
Ca2+ staining is an experimental technique that utilizes specific fluorescent probes (such as Fluo-4 AM, Fura-2, etc.) to qualitatively or quantitatively detect dynamic changes in intracellular Ca2+ concentrations; this is achieved by monitoring the changes in fluorescent signals generated when these probes bind to free intracellular calcium ions. The underlying principle relies primarily on the presence of chelating groups within the probe's molecular structure that possess high affinity for calcium ions.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)