14-3-3 zeta Protein, Human (sf9, His)

14-3-3 zeta Protein, Human (sf9, His) is the recombinant human-derived 14-3-3 zeta, expressed by Sf9 insect cells, with His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

14-3-3 zeta Protein, Human (sf9, His) is the recombinant human-derived 14-3-3 zeta, expressed by Sf9 insect cells, with His labeled tag.

Background

14-3-3 zeta is an adapter protein involved in regulating a broad spectrum of general and specialized signaling pathways. It binds to numerous partner proteins, typically by recognizing phosphoserine or phosphothreonine motifs, often resulting in modulation of the partner's activity. This protein promotes cytoplasmic retention and inactivation of the TFEB transcription factor by binding to phosphorylated TFEB. Additionally, it enhances ARHGEF7 activity on RAC1 and facilitates lamellipodia and membrane ruffle formation. In neurons, 14-3-3 zeta regulates spine maturation through modulation of ARHGEF7 activity (By similar).

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag His
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    YWHAZ; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Zeta; YWHAD; KCIP-1; 14-3-3-Zeta; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; Delta Polypeptide; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activ

  • AA Sequence

    MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

  • Molecular Weight

    Approximately 31 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00