Copy Link Print Information

14-3-3 zeta Protein, Mouse (sf9, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

14-3-3 zeta Protein, Mouse (sf9, His) is the recombinant mouse-derived 14-3-3 zeta, expressed by Sf9 insect cells, with His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • 14-3-3 zeta Protein, Mouse (sf9, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

14-3-3 zeta Protein, Mouse (sf9, His) is the recombinant mouse-derived 14-3-3 zeta, expressed by Sf9 insect cells, with His labeled tag.

Background

14-3-3 zeta is an adapter protein involved in regulating a broad spectrum of general and specialized signaling pathways. It binds to numerous partners via recognition of phosphoserine or phosphothreonine motifs, typically modulating the activity of bound partners. The protein promotes cytoplasmic retention and inactivation of phosphorylated TFEB. By similarity, it enhances ARHGEF7 activity on RAC1 to induce lamellipodia and membrane ruffle formation, and in neurons, regulates spine maturation through ARHGEF7 activity modulation (By similarity).

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag N-His
  • Accession

    P63101 (M1-N245)

  • Gene ID
    22631
  • Protein Length

    Full Length

  • Synonyms

    YWHAZ; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Zeta; YWHAD; KCIP-1; 14-3-3-Zeta; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; Delta Polypeptide; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase

  • AA Sequence

    MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN

  • Predicted Molecular Mass

    31 kDa

  • Molecular Weight

    Approximately 31 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 14-3-3 zeta Protein, Mouse (sf9, His) Product Image
    1/16
  • 14-3-3 zeta Protein, Mouse (sf9, His) Product Image