4-1BB/TNFRSF9 Protein, Rabbit (HEK293, His)

4-1BB/TNFRSF9 Protein lacks conserved residue(s) crucial for feature annotation propagation. 4-1BB/TNFRSF9 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-His labeled tag.

The 4-1BB/TNFRSF9 protein is marked by an absence of conserved residue(s) necessary for the propagation of feature annotation.

Immobilized Human 4‑1BB Ligand Fc at 2 μg/mL (100 μL/well) can bind Rabbit 4-1BB His with a linear range of 1-39 ng/mL.

Rabbit

HEK293

C-His

G1SHD7-1 (V29-I191)

100348914  [NCBI]

Partial

VQGPCANCPAGTFCGKSRNPIFVPCPPNSLSCGSGQRTCVLCRRCEGVFRTKKPCSPTSDTECECIAGFHCLGPGCSMCEQDCEQGQEFTKEGCKDCPFGSFNNQKGGICQPWTNCSGGRPVLVNGTKDSDVVCGPTAPGFSPGASSTTSPPPPPAGHSPQVI

Approximately 27-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.