A29 Protein, Monkeypox virus (His)

A29 Protein, Monkeypox virus (His) is the recombinant virus-derived A29 protein, expressed by E. coli, with N-His tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: E. coli
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

A29 Protein, Monkeypox virus (His) is the recombinant virus-derived A29 protein, expressed by E. coli, with N-His tag.

Background

Mpox virus (MPXV) A29 protein is a small protein with a molecular weight of approximately 14 kDa. Vaccinia virus (MPXV), formerly known as monkeypox virus, became a global epidemic in 2022. Most seroprevalence or vaccine studies use live MPXV (or vaccinia virus [VACV]) or inactivated MPXV (or VACV) culture lysates for serological testing, but MPXV culture can only be performed in biosafety level 3 (BSL-3) facilities.

Technical Parameters

  • Species Virus
  • Source E. coli
  • Tag N-8*His
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    MPXVgp139; MPXV-M5312_HM12_Rivers-138

  • AA Sequence

    MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRHPYE

  • Predicted Molecular Mass

    13.7 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00