A29 Protein, Monkeypox virus (His)
A29 Protein, Monkeypox virus (His) is the recombinant virus-derived A29 protein, expressed by E. coli, with N-His tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
A29 Protein, Monkeypox virus (His) is the recombinant virus-derived A29 protein, expressed by E. coli, with N-His tag.
Background
Mpox virus (MPXV) A29 protein is a small protein with a molecular weight of approximately 14 kDa. Vaccinia virus (MPXV), formerly known as monkeypox virus, became a global epidemic in 2022. Most seroprevalence or vaccine studies use live MPXV (or vaccinia virus [VACV]) or inactivated MPXV (or VACV) culture lysates for serological testing, but MPXV culture can only be performed in biosafety level 3 (BSL-3) facilities.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag N-8*His
-
Accession
Q90188 (M1-E110)
-
Gene ID/
-
Protein Length
Full Length
-
Synonyms
MPXVgp139; MPXV-M5312_HM12_Rivers-138
-
AA Sequence
MDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRHPYE
-
Predicted Molecular Mass
13.7 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)