A30 Protein, Monkeypox virus (HEK293, His)
A30 Protein, Monkeypox virus (HEK293, His) is the recombinant virus-derived A30 protein, expressed by HEK293, with N-His tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
A30 Protein, Monkeypox virus (HEK293, His) is the recombinant virus-derived A30 protein, expressed by HEK293, with N-His tag.
Background
A30 is an envelope protein essential for virus entry into host cells and for cell-cell fusion (syncytium formation).
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag N-8*His
-
Accession
Q8V4U9 (Q22-L146)
-
Gene ID928965
-
Protein Length
Virion surface domain
-
Synonyms
Envelope protein OPG155; Protein A30; OPG155; A30L
-
AA Sequence
QSYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMRQCIDFTFSDVINIDIYNPCIAPNINNTECQFLKSVL
-
Predicted Molecular Mass
15.2 kDa
-
Molecular Weight
Approximately 25-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)