ACAA1 Protein, Human (sf9, His)
The ACAA1 protein catalyzes the thiolytic cleavage of various straight-chain 3-keto fatty acyl-CoAs, playing a vital role in peroxisomal beta-oxidation of short to very long 3-oxoacyl-CoAs. ACAA1 Protein, Human (sf9, His) is the recombinant human-derived ACAA1 protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The ACAA1 protein catalyzes the thiolytic cleavage of various straight-chain 3-keto fatty acyl-CoAs, playing a vital role in peroxisomal beta-oxidation of short to very long 3-oxoacyl-CoAs. ACAA1 Protein, Human (sf9, His) is the recombinant human-derived ACAA1 protein, expressed by Sf9 insect cells , with N-His labeled tag.
The ACAA1 protein is responsible for the thiolytic cleavage of straight-chain 3-keto fatty acyl-CoAs (3-oxoacyl-CoAs). It plays a crucial role in fatty acid peroxisomal beta-oxidation, exhibiting catalytic activity in the cleavage of short, medium, long, and very long straight-chain 3-oxoacyl-CoAs.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
P09110 (L27-N424)
-
Molecular Construction
-
N-term
-
His
-
ACAA1 (L27-N424)
Accession # P09110 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ACAA1; Testicular Tissue Protein Li 197; Acetyl-CoA Acyltransferase 1; Beta-Ketothiolase; Lnc-Myd88; PTHIO; Epididymis Secretory Sperm Binding Protein; ACAA; Peroxisomal 3-Oxoacyl-Coenzyme A Thiolase; Acetyl-Coenzyme A Acyltransferase 1 (Peroxisomal 3-Oxo
-
AA Sequence
LSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
-
Predicted Molecular Mass
43.8 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
