Activin RIA Protein, Human (Active, sf9, His-GST)
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-6*His;N-GST
-
Accession
Q04771 (R147-C509)
-
Gene ID90
-
Molecular Construction
-
N-term
-
His-GST
-
ACVR1 (R147-C509)
Accession # Q04771 -
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
ACVR1; Activin A Receptor, Type II-Like Kinase 2; Prev. ACVRLK2; Receptor Protein Serine/Threonine Kinase; SKR1; Hydroxyalkyl-Protein Kinase; TGF-B Superfamily Receptor Type I; Alternative Protein ACVR1; Activin Receptor Type-1; ACTR-I; Activin Receptor T
-
AA Sequence
RKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQVKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
-
Predicted Molecular Mass
71.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
