AGER Protein, Cynomolgus (HEK293, His)
AGER protein is a cell surface pattern recognition receptor that can sense endogenous stress signals from a variety of ligands, such as S100 protein, HMGB1, β-amyloid, etc. AGER Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AGER protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
AGER protein is a cell surface pattern recognition receptor that can sense endogenous stress signals from a variety of ligands, such as S100 protein, HMGB1, β-amyloid, etc. AGER Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AGER protein, expressed by HEK293 , with C-His labeled tag.
Background
AGER protein serves as a cell surface pattern recognition receptor with a diverse ligand repertoire, encompassing advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Notably, advanced glycosylation end products, which accumulate in vascular tissue during aging and diabetes, act as key ligands triggering inflammatory responses via RAGE. Upon ligand binding, AGER utilizes TIRAP and MYD88 as adapters to transduce signals, leading to the induction of inflammatory cytokines such as IL6, IL8, and TNFalpha through NF-kappa-B activation. AGER's interaction with S100A12 and S100B induces cellular activation, generating pro-inflammatory mediators and contributing to diverse processes, including myocardial infarction-induced apoptosis, amyloid-beta peptide translocation, endothelial albumin transcytosis, and extracellular vesicle-mediated delivery of HMGB1 to hepatocytes. Moreover, AGER participates in the uptake of extracellular hypomethylated DNA and can induce nuclear factor NF-kappa-B activation in response to advanced glycosylation end products. The multifaceted roles of AGER highlight its involvement in various pathological conditions, such as diabetes, vascular complications, neurodegenerative disorders, and cancer.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
A0A2K5TSM4 (Q24-T354)
-
Gene ID/
-
Molecular Construction
-
N-term
-
AGER (Q24-T354)
Accession # A0A2K5TSM4 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
AGER; Receptor For Advanced Glycosylation End-Products Deletion Exon3-10 Variant; Advanced Glycosylation End-Product Specific Receptor; Receptor For Advanced Glycosylation End-Products Deletion Exon2-6 Variant; RAGE; Advanced Glycosylation End Product-Spe
-
AA Sequence
QNITARIGEPLVLKCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIIDSASELTAGVPNKVVKERRSRKWSCEQEVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEETRRHPETGLFTLQSELMVTPARGGNPHPTFSCSFSPGLPRRRALHTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLSPSPVLILPEIGPQDQGTYRCVATHPSHRPQESRAVSISIIEPGEEGPTAGSVGGSGPGT
-
Predicted Molecular Mass
36.8 kDa
-
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)