1. Recombinant Proteins
  2. Receptor Proteins
  3. AGER Protein, Cynomolgus (HEK293, His)

AGER protein is a cell surface pattern recognition receptor that can sense endogenous stress signals from a variety of ligands, such as S100 protein, HMGB1, β-amyloid, etc. AGER Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AGER protein is a cell surface pattern recognition receptor that can sense endogenous stress signals from a variety of ligands, such as S100 protein, HMGB1, β-amyloid, etc. AGER Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

Background

AGER protein serves as a cell surface pattern recognition receptor with a diverse ligand repertoire, encompassing advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Notably, advanced glycosylation end products, which accumulate in vascular tissue during aging and diabetes, act as key ligands triggering inflammatory responses via RAGE. Upon ligand binding, AGER utilizes TIRAP and MYD88 as adapters to transduce signals, leading to the induction of inflammatory cytokines such as IL6, IL8, and TNFalpha through NF-kappa-B activation. AGER's interaction with S100A12 and S100B induces cellular activation, generating pro-inflammatory mediators and contributing to diverse processes, including myocardial infarction-induced apoptosis, amyloid-beta peptide translocation, endothelial albumin transcytosis, and extracellular vesicle-mediated delivery of HMGB1 to hepatocytes. Moreover, AGER participates in the uptake of extracellular hypomethylated DNA and can induce nuclear factor NF-kappa-B activation in response to advanced glycosylation end products. The multifaceted roles of AGER highlight its involvement in various pathological conditions, such as diabetes, vascular complications, neurodegenerative disorders, and cancer.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

A0A2K5TSM4 (Q24-T354)

Gene ID

/

Molecular Construction
N-term
AGER (Q24-T354)
Accession # A0A2K5TSM4
8*His
C-term
Protein Length

Extracellular Domain

Synonyms
Advanced glycosylation end-product specific receptor; AGER; RAGE; SCARJ1
AA Sequence

QNITARIGEPLVLKCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIIDSASELTAGVPNKVVKERRSRKWSCEQEVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEETRRHPETGLFTLQSELMVTPARGGNPHPTFSCSFSPGLPRRRALHTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLSPSPVLILPEIGPQDQGTYRCVATHPSHRPQESRAVSISIIEPGEEGPTAGSVGGSGPGT

Predicted Molecular Mass
36.8 kDa
Molecular Weight

Approximately 50-65 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

AGER Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AGER Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AGER Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P701085
Quantity:
MCE Japan Authorized Agent: