AGER Protein, Cynomolgus (HEK293, His)

AGER protein is a cell surface pattern recognition receptor that can sense endogenous stress signals from a variety of ligands, such as S100 protein, HMGB1, β-amyloid, etc. AGER Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

AGER protein is a cell surface pattern recognition receptor that can sense endogenous stress signals from a variety of ligands, such as S100 protein, HMGB1, β-amyloid, etc. AGER Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived AGER protein, expressed by HEK293 , with C-His labeled tag.

Background

AGER protein serves as a cell surface pattern recognition receptor with a diverse ligand repertoire, encompassing advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Notably, advanced glycosylation end products, which accumulate in vascular tissue during aging and diabetes, act as key ligands triggering inflammatory responses via RAGE. Upon ligand binding, AGER utilizes TIRAP and MYD88 as adapters to transduce signals, leading to the induction of inflammatory cytokines such as IL6, IL8, and TNFalpha through NF-kappa-B activation. AGER's interaction with S100A12 and S100B induces cellular activation, generating pro-inflammatory mediators and contributing to diverse processes, including myocardial infarction-induced apoptosis, amyloid-beta peptide translocation, endothelial albumin transcytosis, and extracellular vesicle-mediated delivery of HMGB1 to hepatocytes. Moreover, AGER participates in the uptake of extracellular hypomethylated DNA and can induce nuclear factor NF-kappa-B activation in response to advanced glycosylation end products. The multifaceted roles of AGER highlight its involvement in various pathological conditions, such as diabetes, vascular complications, neurodegenerative disorders, and cancer.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • AGER (Q24-T354)
      Accession # A0A2K5TSM4
    • 8*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    AGER; Receptor For Advanced Glycosylation End-Products Deletion Exon3-10 Variant; Advanced Glycosylation End-Product Specific Receptor; Receptor For Advanced Glycosylation End-Products Deletion Exon2-6 Variant; RAGE; Advanced Glycosylation End Product-Spe

  • AA Sequence

    QNITARIGEPLVLKCKGAPKKPPQQLEWKLNTGRTEAWKVLSPQGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIIDSASELTAGVPNKVVKERRSRKWSCEQEVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEETRRHPETGLFTLQSELMVTPARGGNPHPTFSCSFSPGLPRRRALHTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLSPSPVLILPEIGPQDQGTYRCVATHPSHRPQESRAVSISIIEPGEEGPTAGSVGGSGPGT

  • Predicted Molecular Mass

    36.8 kDa

  • Molecular Weight

    Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00