AGRP Protein, Mouse (HEK293, His)
The AGRP protein is critical for body weight homeostasis and regulates feeding behavior through the central melanocortin system. As an antagonist of alpha melanocyte-stimulating hormone, AGRP inhibits cAMP production through melanocortin receptors in the hypothalamus and adrenal glands. AGRP Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The AGRP protein is critical for body weight homeostasis and regulates feeding behavior through the central melanocortin system. As an antagonist of alpha melanocyte-stimulating hormone, AGRP inhibits cAMP production through melanocortin receptors in the hypothalamus and adrenal glands. AGRP Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.
Background
The AGRP protein plays a crucial role in maintaining weight homeostasis. It is involved in the regulation of feeding behavior through the central melanocortin system. AGRP acts as an antagonist of alpha melanocyte-stimulating hormone by inhibiting cAMP production mediated by the stimulation of melanocortin receptors in the hypothalamus and adrenal gland. It exhibits minimal activity with MC5R but functions as an inverse agonist for MC3R and MC4R, effectively suppressing their constitutive activity. AGRP also promotes the endocytosis of MC3R and MC4R in an arrestin-dependent manner. Furthermore, it interacts with melanocortin receptors MC3R, MC4R, and MC5R.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P56473 (V21-T131)
-
Molecular Construction
-
N-term
-
AGRP (V21-T131)
Accession # P56473 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein (with Propeptide)
-
Synonyms
AGRP; Agrt; Agouti Related Neuropeptide; Agouti Related Protein Homolog (Mouse); ART; Agouti (Mouse) Related Protein; Agouti-Related Protein; Agouti Related Protein Homolog; ASIP2; AGRT
-
AA Sequence
VQMGVAPLKGIRRPDQALFPEFPGLSLNGLKKTTADRAEEVLLQKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT
-
Predicted Molecular Mass
13.7 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
