1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. AGRP Protein, Mouse (HEK293, His)

The AGRP protein is critical for body weight homeostasis and regulates feeding behavior through the central melanocortin system. As an antagonist of alpha melanocyte-stimulating hormone, AGRP inhibits cAMP production through melanocortin receptors in the hypothalamus and adrenal glands. AGRP Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The AGRP protein is critical for body weight homeostasis and regulates feeding behavior through the central melanocortin system. As an antagonist of alpha melanocyte-stimulating hormone, AGRP inhibits cAMP production through melanocortin receptors in the hypothalamus and adrenal glands. AGRP Protein, Mouse (HEK293, His) is the recombinant mouse-derived AGRP protein, expressed by HEK293 , with C-His labeled tag.

Background

The AGRP protein plays a crucial role in maintaining weight homeostasis. It is involved in the regulation of feeding behavior through the central melanocortin system. AGRP acts as an antagonist of alpha melanocyte-stimulating hormone by inhibiting cAMP production mediated by the stimulation of melanocortin receptors in the hypothalamus and adrenal gland. It exhibits minimal activity with MC5R but functions as an inverse agonist for MC3R and MC4R, effectively suppressing their constitutive activity. AGRP also promotes the endocytosis of MC3R and MC4R in an arrestin-dependent manner. Furthermore, it interacts with melanocortin receptors MC3R, MC4R, and MC5R.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

P56473 (V21-T131)

Gene ID
Molecular Construction
N-term
AGRP (V21-T131)
Accession # P56473
His
C-term
Protein Length

Full Length

Synonyms
Agouti-related protein; AGRP; AGRT; ART
AA Sequence

VQMGVAPLKGIRRPDQALFPEFPGLSLNGLKKTTADRAEEVLLQKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT

Predicted Molecular Mass
13.7 kDa
Molecular Weight

Approximately 20 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

AGRP Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AGRP Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AGRP Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75523
Quantity:
MCE Japan Authorized Agent: