Allergin-1 Protein, Human (HEK293, Fc)
Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, Fc) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, Fc) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
Allergin-1 Protein, an immunoglobulin-like receptor, functions as a negative regulator in mast cells by inhibiting degranulation. Specifically, it plays a crucial role in suppressing IgE-mediated mast cell activation, thereby dampening the type I immediate hypersensitivity reaction. Allergin-1 operates as a monomer and interacts with key signaling molecules, including tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that contribute to its inhibitory effects on mast cell degranulation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q7Z6M3-1 (R20-K227)
-
Molecular Construction
-
N-term
-
Allergin-1 (R20-K227)
Accession # Q7Z6M3-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MILR1; MCA-32; Prev. C17orf60; MCA32; Allergin-1; Probable Mast Cell Antigen 32 Homolog; Allergy Inhibitory Receptor 1; Chromosome 17 Open Reading Frame 60; Mast Cell Antigen 32; Mast Cell Immunoglobulin Like Receptor 1; Mast Cell Immunoglobulin-Like Rece
-
AA Sequence
RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK
-
Predicted Molecular Mass
50.1 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
