Allergin-1 Protein, Human (HEK293, Fc)

Allergin-1 Protein, an immunoglobulin-like receptor, crucially acts as a negative regulator in mast cells, inhibiting degranulation. Operating as a monomer, it interacts with signaling molecules like tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that suppress IgE-mediated mast cell activation, thus dampening type I immediate hypersensitivity reactions. Allergin-1 Protein, Human (HEK293, Fc) is the recombinant human-derived Allergin-1 protein, expressed by HEK293 , with C-hFc labeled tag.

Allergin-1 Protein, an immunoglobulin-like receptor, functions as a negative regulator in mast cells by inhibiting degranulation. Specifically, it plays a crucial role in suppressing IgE-mediated mast cell activation, thereby dampening the type I immediate hypersensitivity reaction. Allergin-1 operates as a monomer and interacts with key signaling molecules, including tyrosine-phosphorylated PTPN6, PTPN11, and INPP5D, forming complexes that contribute to its inhibitory effects on mast cell degranulation.

Human

HEK293

C-hFc

Q7Z6M3-1 (R20-K227)

284021  [NCBI]

Extracellular Domain

RKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKNKSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFTIVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAEFNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLK

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/es4-cell.html