Aminoacylase-1 Protein, Human (sf9, His)
The Aminoacylase-1 protein plays a crucial role in catalyzing the hydrolysis of N-acetylated amino acids, leading to the production of acetate and free amino acids. Aminoacylase-1 Protein, Human (sf9, His) is the recombinant human-derived Aminoacylase-1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Aminoacylase-1 protein plays a crucial role in catalyzing the hydrolysis of N-acetylated amino acids, leading to the production of acetate and free amino acids. Aminoacylase-1 Protein, Human (sf9, His) is the recombinant human-derived Aminoacylase-1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Aminoacylase-1 Protein, an enzyme, plays a crucial role in the hydrolysis of N-acylated amino acids. Dysregulation of Aminoacylase-1 Protein has been associated with metabolic disorders and neurological diseases. Targeting Aminoacylase-1 Protein may offer potential therapeutic interventions in these conditions by modulating amino acid metabolism, improving metabolic function, and managing neurological disorders.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q03154 (M1-S408)
-
Molecular Construction
-
N-term
-
Aminoacylase-1 (M1-S408)
Accession # Q03154 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
ACY1; Epididymis Secretory Protein Li 5; Aminoacylase 1; Aminoacylase 1 Isoform 2; N-Acyl-L-Amino-Acid Amidohydrolase; HEL-S-5; Aminoacylase-1; Acylase; ACY-1; ACY1D; N-Acyl-Aliphatic-L-Amino Acid Amidohydrolase
-
AA Sequence
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
-
Predicted Molecular Mass
47.3 kDa
-
Molecular Weight
Approximately 44 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
