1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Aminoacylase-1 Protein, Human (sf9, His)

The Aminoacylase-1 protein plays a crucial role in catalyzing the hydrolysis of N-acetylated amino acids, leading to the production of acetate and free amino acids. Aminoacylase-1 Protein, Human (sf9, His) is the recombinant human-derived Aminoacylase-1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
50 μg 견적 받기 2 - 3 weeks 1 - 2 Weeks 3 - 4 weeks 2 - 3 weeks
100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The Aminoacylase-1 protein plays a crucial role in catalyzing the hydrolysis of N-acetylated amino acids, leading to the production of acetate and free amino acids. Aminoacylase-1 Protein, Human (sf9, His) is the recombinant human-derived Aminoacylase-1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Aminoacylase-1 Protein, an enzyme, plays a crucial role in the hydrolysis of N-acylated amino acids. Dysregulation of Aminoacylase-1 Protein has been associated with metabolic disorders and neurological diseases. Targeting Aminoacylase-1 Protein may offer potential therapeutic interventions in these conditions by modulating amino acid metabolism, improving metabolic function, and managing neurological disorders.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q03154 (M1-S408)

Gene ID

95  [NCBI]

Molecular Construction
N-term
Aminoacylase-1 (M1-S408)
Accession # Q03154
His
C-term
Protein Length

Full Length

Synonyms
Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; Acy1
AA Sequence

MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS

Predicted Molecular Mass
47.3 kDa
분자량

Approximately 44 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 100 mM NaCl, pH 8.0, 10% Glycerol. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Aminoacylase-1 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Aminoacylase-1 Protein, Human (sf9, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Aminoacylase-1 Protein, Human (sf9, His)
Cat. No.:
HY-P75576
수량:
MCE Japan Authorized Agent: