Amphiregulin Protein, Mouse (His)
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Background
Amphiregulin, a ligand for the EGF receptor (EGFR), functions as both an autocrine growth factor and a mitogen for a diverse array of target cells, such as astrocytes, Schwann cells, and fibroblasts. Its impact spans cellular proliferation, and during its immature precursor stage, Amphiregulin engages in interactions with CNIH. This versatile ligand's capacity to activate EGFR underscores its crucial role in regulating cell growth and underscores its significance in orchestrating various cellular functions across different cell types.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P31955 (V100-K191)
-
Gene ID11839
-
Protein Length
Partial Extracellular Domain
-
Synonyms
AREG; AR; Prev. AREGB; Schwannoma-Derived Growth Factor; Prev. SDGF; Amphiregulin B; CRDGF; Amphiregulin; Colorectum Cell-Derived Growth Factor
-
AA Sequence
VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSK
-
Predicted Molecular Mass
17.5 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
