AMY2B Protein, Human (HEK293, His)
Based on 1 Customer Validation
AMY2B Protein, Human (HEK293, His) is produced by HEK293 cells. AMY2B is a type of human alpha-amylase.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
AMY2B Protein, Human (HEK293, His) is produced by HEK293 cells. AMY2B is a type of human alpha-amylase[1].
Background
Human alpha-amylases are mainly produced in the salivary gland and the pancreas. AMY2B is a third type of human alpha-amylase gene, which is expressed in a lung carcinoid tissue, and differs in nucleotide sequence from the two previously characterized human alpha -amylase genes coding for salivary and pancreatic isozymes, termed AMYI and AMY2, respectively[1].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P19961 (Q16-L511)
-
Molecular Construction
-
N-term
-
AMY2B (Q16-L511)
Accession # P19961 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
AMY2B; Alpha-Amylase 2B; Prev. AMY2; Glycogenase; 1,4-Alpha-D-Glucan Glucanohydrolase 2B; AMY3; Amylase Alpha 2B (Pancreatic); HXA; Carcinoid Alpha-Amylase; Amylase Alpha 2B; Amylase, Alpha 2B; Pancreatic
-
AA Sequence
QYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
-
Predicted Molecular Mass
56.9 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filter solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
