1. Recombinant Proteins
  2. Others
  3. Amyloid Precursor/Beta-APP40 Protein, Human (His-GST)

Amyloid Precursor/Beta-APP40 Protein, Human (His-GST)

Cat. No.: HY-P75511
Handling Instructions Technical Support

Amyloid Precursor/Beta-APP40 Protein, Human (His-GST) is the recombinant human-derived Amyloid Precursor/Beta-APP40 protein, expressed by E. coli , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Amyloid Precursor/Beta-APP40 Protein, Human (His-GST) is the recombinant human-derived Amyloid Precursor/Beta-APP40 protein, expressed by E. coli , with N-His, N-GST labeled tag.

Background

APP (Amyloid Precursor Protein), also known as Protease Nexin-II, operates as a multifunctional cell surface receptor, exerting physiological effects on neurons that are crucial for neurite growth, neuronal adhesion, and axonogenesis. Its involvement in synaptogenesis is highlighted by the promotion of synaptic connections through interactions between APP molecules on adjacent cells. Beyond cell adhesion, APP plays a role in cell mobility and transcriptional regulation through protein-protein interactions. It can stimulate transcription activation by binding to APBB1-KAT5 and inhibit Notch signaling through interaction with Numb. Additionally, APP couples to apoptosis-inducing pathways, such as those mediated by G(o) and JIP, and inhibits G(o) alpha ATPase activity. Acting as a kinesin I membrane receptor, APP facilitates axonal transport of beta-secretase and presenilin 1, contributing to axonal anterograde cargo transport towards synapses. In the context of copper homeostasis, APP is involved in copper ion reduction and can induce neuronal death through copper-metallated interactions. Furthermore, APP regulates neurite outgrowth by binding to extracellular matrix components and possesses protease inhibitor activity through its BPTI domain-containing isoforms. The protein participates in the AGER-dependent pathway, activating p38 MAPK and inducing internalization of amyloid-beta peptide, leading to mitochondrial dysfunction. Additionally, APP provides Cu(2+) ions for GPC1, required for nitric oxide release and heparan sulfate degradation. It exhibits metal-chelating properties, reduces transient metals, and binds to lipoproteins, apolipoproteins, and HDL particles, thereby modulating metal-catalyzed oxidation. APP's intricate involvement in various cellular processes underscores its significance in both normal neuronal function and pathological conditions associated with neurodegenerative disorders.

Species

Human

Source

E. coli

Tag

N-His;N-GST

Accession

P05067-1 (D672-V711)

Gene ID

351  [NCBI]

Molecular Construction
N-term
His-GST
APP (D672-V711)
Accession # P05067-1
C-term
Protein Length

Full Length of APP40

Synonyms
Amyloid-beta precursor protein; APP; Protease Nexin II; PreA4
AA Sequence

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Predicted Molecular Mass
31.8 kDa
Molecular Weight

Approximately 33 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Amyloid Precursor/Beta-APP40 Protein, Human (His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Amyloid Precursor/Beta-APP40 Protein, Human (His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Amyloid Precursor/Beta-APP40 Protein, Human (His-GST)
Cat. No.:
HY-P75511
Quantity:
MCE Japan Authorized Agent: