Amyloid Precursor/Beta-APP40 Protein, Human (His-GST)
Amyloid Precursor/Beta-APP40 Protein, Human (His-GST) is the recombinant human-derived Amyloid Precursor/Beta-APP40 protein, expressed by E. coli , with N-His, N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Amyloid Precursor/Beta-APP40 Protein, Human (His-GST) is the recombinant human-derived Amyloid Precursor/Beta-APP40 protein, expressed by E. coli , with N-His, N-GST labeled tag.
Background
APP (Amyloid Precursor Protein), also known as Protease Nexin-II, operates as a multifunctional cell surface receptor, exerting physiological effects on neurons that are crucial for neurite growth, neuronal adhesion, and axonogenesis. Its involvement in synaptogenesis is highlighted by the promotion of synaptic connections through interactions between APP molecules on adjacent cells. Beyond cell adhesion, APP plays a role in cell mobility and transcriptional regulation through protein-protein interactions. It can stimulate transcription activation by binding to APBB1-KAT5 and inhibit Notch signaling through interaction with Numb. Additionally, APP couples to apoptosis-inducing pathways, such as those mediated by G(o) and JIP, and inhibits G(o) alpha ATPase activity. Acting as a kinesin I membrane receptor, APP facilitates axonal transport of beta-secretase and presenilin 1, contributing to axonal anterograde cargo transport towards synapses. In the context of copper homeostasis, APP is involved in copper ion reduction and can induce neuronal death through copper-metallated interactions. Furthermore, APP regulates neurite outgrowth by binding to extracellular matrix components and possesses protease inhibitor activity through its BPTI domain-containing isoforms. The protein participates in the AGER-dependent pathway, activating p38 MAPK and inducing internalization of amyloid-beta peptide, leading to mitochondrial dysfunction. Additionally, APP provides Cu(2+) ions for GPC1, required for nitric oxide release and heparan sulfate degradation. It exhibits metal-chelating properties, reduces transient metals, and binds to lipoproteins, apolipoproteins, and HDL particles, thereby modulating metal-catalyzed oxidation. APP's intricate involvement in various cellular processes underscores its significance in both normal neuronal function and pathological conditions associated with neurodegenerative disorders.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-GST
-
Accession
P05067-1 (D672-V711)
-
Molecular Construction
-
N-term
-
His-GST
-
APP (D672-V711)
Accession # P05067-1 -
C-term
-
-
Protein Length
Full Length of APP40 Chain
-
Synonyms
APP; PreA4; Prev. AD1; CVAP; Alzheimer Disease Amyloid A4 Protein Homolog; Beta-Amyloid Precursor Protein; Amyloid-Beta Precursor Protein; Testicular Tissue Protein Li 2; Amyloid Precursor Protein; Beta-Amyloid Peptide(1-40); Alpha-SAPP; Beta-Amyloid Pept
-
AA Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
-
Predicted Molecular Mass
31.8 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)