Amyloid Precursor/Beta-APP40 Protein, Human (His-GST)

Amyloid Precursor/Beta-APP40 Protein, Human (His-GST) is the recombinant human-derived Amyloid Precursor/Beta-APP40 protein, expressed by E. coli , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Amyloid Precursor/Beta-APP40 Protein, Human (His-GST) is the recombinant human-derived Amyloid Precursor/Beta-APP40 protein, expressed by E. coli , with N-His, N-GST labeled tag.

Background

APP (Amyloid Precursor Protein), also known as Protease Nexin-II, operates as a multifunctional cell surface receptor, exerting physiological effects on neurons that are crucial for neurite growth, neuronal adhesion, and axonogenesis. Its involvement in synaptogenesis is highlighted by the promotion of synaptic connections through interactions between APP molecules on adjacent cells. Beyond cell adhesion, APP plays a role in cell mobility and transcriptional regulation through protein-protein interactions. It can stimulate transcription activation by binding to APBB1-KAT5 and inhibit Notch signaling through interaction with Numb. Additionally, APP couples to apoptosis-inducing pathways, such as those mediated by G(o) and JIP, and inhibits G(o) alpha ATPase activity. Acting as a kinesin I membrane receptor, APP facilitates axonal transport of beta-secretase and presenilin 1, contributing to axonal anterograde cargo transport towards synapses. In the context of copper homeostasis, APP is involved in copper ion reduction and can induce neuronal death through copper-metallated interactions. Furthermore, APP regulates neurite outgrowth by binding to extracellular matrix components and possesses protease inhibitor activity through its BPTI domain-containing isoforms. The protein participates in the AGER-dependent pathway, activating p38 MAPK and inducing internalization of amyloid-beta peptide, leading to mitochondrial dysfunction. Additionally, APP provides Cu(2+) ions for GPC1, required for nitric oxide release and heparan sulfate degradation. It exhibits metal-chelating properties, reduces transient metals, and binds to lipoproteins, apolipoproteins, and HDL particles, thereby modulating metal-catalyzed oxidation. APP's intricate involvement in various cellular processes underscores its significance in both normal neuronal function and pathological conditions associated with neurodegenerative disorders.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • APP (D672-V711)
      Accession # P05067-1
    • C-term
  • Protein Length

    Full Length of APP40 Chain

  • Synonyms

    APP; PreA4; Prev. AD1; CVAP; Alzheimer Disease Amyloid A4 Protein Homolog; Beta-Amyloid Precursor Protein; Amyloid-Beta Precursor Protein; Testicular Tissue Protein Li 2; Amyloid Precursor Protein; Beta-Amyloid Peptide(1-40); Alpha-SAPP; Beta-Amyloid Pept

  • AA Sequence

    DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

  • Predicted Molecular Mass

    31.8 kDa

  • Molecular Weight

    Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00