1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Neurotrophic Factors
  4. CDNF/MANF family
  5. CDNF
  6. Animal-Free CDNF Protein, Mouse (His)

CDNF (cerebral dopamine neurotrophic factor) emerges as a key trophic factor for dopamine neurons that counteracts 6-hydroxydopamine (6-OHDA)-induced degeneration. Notably, it can restore dopaminergic function and prevent nigral neuronal degeneration after 6-OHDA injury. Animal-Free CDNF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCDNF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
2 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

CDNF (cerebral dopamine neurotrophic factor) emerges as a key trophic factor for dopamine neurons that counteracts 6-hydroxydopamine (6-OHDA)-induced degeneration. Notably, it can restore dopaminergic function and prevent nigral neuronal degeneration after 6-OHDA injury. Animal-Free CDNF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeCDNF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

CDNF (Cerebral Dopamine Neurotrophic Factor) emerges as a crucial trophic factor for dopamine neurons, exhibiting the ability to counteract the degeneration induced by 6-hydroxydopamine (6-OHDA) in dopaminergic neurons. Particularly notable is its capacity to restore dopaminergic function and shield against the degeneration of neurons in the substantia nigra when administered subsequent to 6-OHDA-induced lesions. This underscores the potential therapeutic relevance of CDNF in mitigating the detrimental effects of neurodegeneration in the context of dopaminergic neurons, offering promise for interventions aimed at preserving and restoring neural function.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

Q8CC36 (Q25-L187)

Gene ID
Molecular Construction
N-term
CDNF (Q25-L187)
Accession # Q8CC36
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Cerebral dopamine neurotrophic factor; CDNF; ARMETL1
AA Sequence

QGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL

Predicted Molecular Mass
19.5 kDa
분자량

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Animal-Free CDNF Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Animal-Free CDNF Protein, Mouse (His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Animal-Free CDNF Protein, Mouse (His)
Cat. No.:
HY-P700166AF
수량:
MCE Japan Authorized Agent: