Animal-Free CNTF Protein, Mouse (His)
Based on 1 Customer Validation
CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family. CNTF could protect retinal cone and rod photoreceptors. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. Animal-Free CNTF Protein, Mouse (His) is produced by E. coli (M1-M198)with C-terminal His-tag.This product is for cell culture use only.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. Animal-Free CNTF Protein, Mouse (His) is produced by E. coli (M1-M198)with C-terminal His-tag.This product is for cell culture use only.
Background
Ciliary Neurotrophic Factor (CNTF) belongs to the IL-6 cytokine family. IL-6, IL-11 and CNTF are associated with cytokine trans signaling. CNTF shows a low affinity interaction with IL-6 receptor subunit alpha (IL-6Rα), leading to the formation and activation of the IL-6Rβ/gp130/LIFR signaling receptor complex[1]. CNTF is also an extracellular signaling protein in the neuroretinal and the interphotoreceptor matrix, which is associated with the membranes of the RPE, Muller and photoreceptor cells[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons. Because it promotes differentiation and maturation of oligodendrocyte precursor cells to oligodendrocytes under in vitro conditions and thus improves remyelination. Importantly, it also increases the survival of mature oligodendrocytes[3]. The similarity of human CNTF protein sequences to mice and rats was 81.82% and 84.0%, respectively.
In Vitro
CNTF (mouse; 10 ng/mL; 1 h) inhibits high-threshold Ca channel currents in fetal mouse cortical neurones[4].
In Vivo
CNTF (mouse; 0.3 mg/kg; i.p.; single dose), injected into the intraperitoneal cavity of C57/Bl6 mice, activates AMPK and increases gene expression[5].
Verified Bioactivity
Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <10 ng/mL. The specific activity of recombinant mouse CNTF is > 1 x 105 IU/mg
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P51642 (M1-M198)
-
Molecular Construction
-
N-term
-
CNTF (M1-M198)
Accession # P51642 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CNTF; HCNTF; Ciliary Neurotrophic Factor; Ciliary Neuronotrophic Factor
-
AA Sequence
MAFAEQSPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNISLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLTLQVSAFAYQLEELMALLEQKVPEKEADGMPVTIGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHHMGISAHESHYGAKQM
-
Predicted Molecular Mass
23.4 kDa
-
Molecular Weight
Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Jones SA, et al. Recent insights into targeting the IL-6 cytokine family in inflammatory diseases and cancer. Nat Rev Immunol. 2018 Dec;18(12):773-789. [Content Brief]
[2]. Li S, et al. Ciliary neurotrophic factor (CNTF) protects retinal cone and rod photoreceptors by suppressing excessive formation of the visual pigments. J Biol Chem. 2018 Sep 28;293(39):15256-15268. [Content Brief]
[3]. Abbaszadeh HA, et al. Human ciliary neurotrophic factor-overexpressing stable bone marrow stromal cells in the treatment of a rat model of traumatic spinal cord injury. Cytotherapy. 2015 Jul;17(7):912-21. [Content Brief]
[4]. Holm NR, et al. CNTF inhibits high voltage activated Ca2+ currents in fetal mouse cortical neurones. J Neurochem. 2002 Aug;82(3):495-503. [Content Brief]
[5]. Watt MJ, et al. CNTF reverses obesity-induced insulin resistance by activating skeletal muscle AMPK. Nat Med. 2006 May;12(5):541-8. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)