Animal-Free CXCL13 Protein, Pig (His)

The CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. Animal-Free CXCL13 Protein, Pig (His) is the recombinant pig-derived animal-FreeCXCL13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

The CXCL13 protein is a member of the intercrine alpha (chemokine CxC) family, signifying its participation in a group of chemokines essential for intercellular communication and immune responses. Within the intercrine alpha family, CXCL13 likely plays a pivotal role in modulating inflammatory processes and influencing cellular interactions. Further exploration is crucial to unveil the specific functions and implications of this protein within the broader context of the chemokine CxC family.

Pig

E. coli

N-6*His

A0A4X1SVT8 (V24-A111)

100524265  [NCBI]

Full Length of Mature Protein

VLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.