Animal-Free CXCL13 Protein, Pig (His)
The CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. Animal-Free CXCL13 Protein, Pig (His) is the recombinant pig-derived animal-FreeCXCL13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
- Species: Pig
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CXCL13 protein is a member of the intercrine α family and is critical for chemokines involved in intercellular communication and immune responses. In this family, CXCL13 may play a key role in regulating inflammatory processes and influencing cellular interactions. Animal-Free CXCL13 Protein, Pig (His) is the recombinant pig-derived animal-FreeCXCL13 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.
Background
The CXCL13 protein is a member of the intercrine alpha (chemokine CxC) family, signifying its participation in a group of chemokines essential for intercellular communication and immune responses. Within the intercrine alpha family, CXCL13 likely plays a pivotal role in modulating inflammatory processes and influencing cellular interactions. Further exploration is crucial to unveil the specific functions and implications of this protein within the broader context of the chemokine CxC family.
Technical Parameters
-
Species Pig
-
Source E. coli
-
Tag N-6*His
-
Accession
A0A4X1SVT8 (V24-A111)
-
Molecular Construction
-
N-term
-
6*His
-
CXCL13 (V24-A111)
Accession # A0A4X1SVT8 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL13; C-X-C Motif Chemokine 13; Prev. SCYB13; CXC Chemokine BLC; BCA-1; BCA1; BLC; B-Cell-Homing Chemokine (Ligand For Burkitt'S Lymphoma Receptor-1); ANGIE2; Chemokine (C-X-C Motif) Ligand 13 (B-Cell Chemoattractant); BLR1L; Chemokine (C-X-C Motif) Lig
-
AA Sequence
VLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA
-
Predicted Molecular Mass
10.8 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
