Animal-Free CXCL13 Protein, Pig (His)

CXCL13 Protein, a member of the intercrine alpha family, is crucial for chemokines involved in intercellular communication and immune responses. Within this family, CXCL13 likely plays a pivotal role in modulating inflammatory processes and influencing cellular interactions. Further exploration is crucial to unveil specific functions and implications within the broader chemokine CxC family, emphasizing its importance in mediating immune responses while adhering to production methods. Animal-Free CXCL13 Protein, Pig (His) is the recombinant pig-derived animal-FreeCXCL13 protein, expressed by E. coli, with N-His labeled tag. The total length of Animal-Free CXCL13 Protein, Pig (His) is 88 a.a., with molecular weight of ~10.81 kDa.

The CXCL13 protein is a member of the intercrine alpha (chemokine CxC) family, signifying its participation in a group of chemokines essential for intercellular communication and immune responses. Within the intercrine alpha family, CXCL13 likely plays a pivotal role in modulating inflammatory processes and influencing cellular interactions. Further exploration is crucial to unveil the specific functions and implications of this protein within the broader context of the chemokine CxC family, emphasizing its importance in mediating immune responses while adhering to production methods.

Pig

E. coli

N-His

A0A4X1SVT8 (V24-A111)

100524265  [NCBI]

VLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA

Approximately 10.81 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<0.1 EU per 1 μg of the protein by the LAL method.