1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-14
  6. Animal-Free FGF-14 Protein, Human (His)

FGF-14 Protein likely plays a crucial role in the development and functioning of the nervous system, contributing to intricate processes underlying neural structure and activity. Its interaction with SCN8A suggests potential involvement in modulating this sodium channel's activity, emphasizing its intricate role in neurophysiology. Animal-Free FGF-14 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-14 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

FGF-14 Protein likely plays a crucial role in the development and functioning of the nervous system, contributing to intricate processes underlying neural structure and activity. Its interaction with SCN8A suggests potential involvement in modulating this sodium channel's activity, emphasizing its intricate role in neurophysiology. Animal-Free FGF-14 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-14 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Background

The FGF-14 protein likely plays a crucial role in the development and functioning of the nervous system, contributing to the intricate processes that underlie neural structure and activity. Its interaction with SCN8A further suggests potential involvement in modulating the activity of this sodium channel, emphasizing its intricate role in neurophysiology.

Actividad biológica

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <21 ng/mL.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q92915-1 (A2-T246)

Gene ID
Molecular Construction
N-term
6*His
FGF-14 (A2-T246)
Accession # Q92915-1
C-term
Protein Length

Partial

Synonyms
Fibroblast growth factor 14; FHF-4; FGF14
AA Sequence

AAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKT

Predicted Molecular Mass
28.3 kDa
Peso molecular

Approximately 33 kDa, based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

Animal-Free FGF-14 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Animal-Free FGF-14 Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Animal-Free FGF-14 Protein, Human (His)
Cat. No.:
HY-P700058AF
Cantidad:
MCE Japan Authorized Agent: