Copy Link Print Information

Animal-Free Galectin-12 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Galectin-12 protein exhibits lactose binding, indicating affinity for specific carbohydrate moieties. Some people believe that Galectin-12 may contribute to adipocyte apoptosis, suggesting that it plays a role in the regulation of adipose tissue homeostasis and programmed cell death. Animal-Free Galectin-12 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-12 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free Galectin-12 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Galectin-12 protein exhibits lactose binding, indicating affinity for specific carbohydrate moieties. Some people believe that Galectin-12 may contribute to adipocyte apoptosis, suggesting that it plays a role in the regulation of adipose tissue homeostasis and programmed cell death. Animal-Free Galectin-12 Protein, Human (His) is the recombinant human-derived animal-FreeGalectin-12 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

Background

The Galectin-12 Protein exhibits the capability to bind lactose, highlighting its affinity for specific carbohydrate moieties. Additionally, there is a suggestion that Galectin-12 may play a role in the apoptosis of adipocytes, implying its potential involvement in the regulation of adipose tissue homeostasis and cellular processes related to programmed cell death within this context. The binding specificity of Galectin-12 to lactose suggests a targeted influence on carbohydrate-mediated interactions, emphasizing its potential significance in the modulation of cellular functions related to adipocyte biology.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    Q96DT0-1 (S2-S336)

  • Gene ID
    85329  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • Galectin-12 (S2-S336)
      Accession # Q96DT0-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    LGALS12; Galectin-12; Galectin 12; Testicular Secretory Protein Li 26; GRIP1; Galectin; Galectin-Related Inhibitor Of Proliferation; Gal-12; Lectin, Galactoside-Binding, Soluble, 12; GAL12

  • AA Sequence

    SQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLKLALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS

  • Predicted Molecular Mass

    38.4 kDa

  • Molecular Weight

    Approximately 38 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free Galectin-12 Protein, Human (His) Product Image
    1/16
  • Animal-Free Galectin-12 Protein, Human (His) Product Image